| Product Number |
ARP46406_P050 |
| Product Page |
www.avivasysbio.com/fcgrt-antibody-n-terminal-region-arp46406-p050.html |
| Name |
FCGRT Antibody - N-terminal region (ARP46406_P050) |
| Protein Size (# AA) |
365 amino acids |
| Molecular Weight |
40kDa |
| Subunit |
p51 |
| NCBI Gene Id |
2217 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Fc fragment of IgG, receptor, transporter, alpha |
| Alias Symbols |
FCRN, alpha-chain |
| Peptide Sequence |
Synthetic peptide located within the following region: GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Cianga,P., (2007) Virchows Arch. 451 (4), 859-860 |
| Description of Target |
FCGRT binds to the Fc region of monomeric immunoglobulins gamma. It mediates the uptake of IgG from milk. It plays a possible role in transfer of immunoglobulin G from mother to fetus. |
| Protein Interactions |
ATG16L1; FCGRT; CA6; B2M; ALB; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FCGRT (ARP46406_P050) antibody |
| Blocking Peptide |
For anti-FCGRT (ARP46406_P050) antibody is Catalog # AAP46406 (Previous Catalog # AAPP27189) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FCGRT |
| Uniprot ID |
P55899 |
| Protein Name |
IgG receptor FcRn large subunit p51 |
| Sample Type Confirmation |
FCGRT is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_004098 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004107 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FCGRT |
| Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Guinea Pig, Horse, Sheep |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Sheep: 79% |
| Image 1 | Human 293T
 | Host: Rabbit
Target Name: FUS
Sample Type: Human 293T cell lysate
Antibody Dilution: 1.0ug/ml |
|
| Image 2 | Human Lung Tissue
 | Rabbit Anti-FCGRT Antibody
Catalog Number: ARP46406_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
Observed Staining: Membrane and cytoplasmic in alveolar type I cells
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
|
|
