ST3GAL5 Antibody - N-terminal region (ARP46385_T100)

Data Sheet
 
Product Number ARP46385_T100
Product Page www.avivasysbio.com/st3gal5-antibody-n-terminal-region-arp46385-t100.html
Name ST3GAL5 Antibody - N-terminal region (ARP46385_T100)
Protein Size (# AA) 418 amino acids
Molecular Weight 48kDa
NCBI Gene Id 8869
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Alias Symbols SATI, SIAT9, SPDRS, ST3GalV, SIATGM3S, ST3Gal V
Peptide Sequence Synthetic peptide located within the following region: DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chung,T.W., (2005) Glycobiology 15 (3), 233-244
Description of Target Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. ST3GAL5 is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. It is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in its gene has been associated with Amish infantile epilepsy syndrome.Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ST3GAL5 (ARP46385_T100) antibody
Additional Information IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Blocking Peptide For anti-ST3GAL5 (ARP46385_T100) antibody is Catalog # AAP46385 (Previous Catalog # AAPP27169)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ST3GAL5
Uniprot ID Q6NZX4
Protein Name Lactosylceramide alpha-2,3-sialyltransferase
Protein Accession # NP_003887
Purification Protein A purified
Nucleotide Accession # NM_003896
Tested Species Reactivity Human
Gene Symbol ST3GAL5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Goat: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Image 1
Human Jurkat
WB Suggested Anti-ST3GAL5 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
Image 2
Human Lung Tumor, 293T Cell Lysate
Host: Rabbit
Target: ST3GAL5
Positive control (+): Human Lung Tumor (T-LU)
Negative control (-): 293T Cell Lysate (2T)
Antibody concentration: 0.2ug/ml
Image 3
Human kidney
Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com