Product Number |
ARP46385_T100 |
Product Page |
www.avivasysbio.com/st3gal5-antibody-n-terminal-region-arp46385-t100.html |
Name |
ST3GAL5 Antibody - N-terminal region (ARP46385_T100) |
Protein Size (# AA) |
418 amino acids |
Molecular Weight |
48kDa |
NCBI Gene Id |
8869 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
ST3 beta-galactoside alpha-2,3-sialyltransferase 5 |
Alias Symbols |
SATI, SIAT9, SPDRS, ST3GalV, SIATGM3S, ST3Gal V |
Peptide Sequence |
Synthetic peptide located within the following region: DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Chung,T.W., (2005) Glycobiology 15 (3), 233-244 |
Description of Target |
Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. ST3GAL5 is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. It is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in its gene has been associated with Amish infantile epilepsy syndrome.Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ST3GAL5 (ARP46385_T100) antibody |
Additional Information |
IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%. |
Blocking Peptide |
For anti-ST3GAL5 (ARP46385_T100) antibody is Catalog # AAP46385 (Previous Catalog # AAPP27169) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ST3GAL5 |
Uniprot ID |
Q6NZX4 |
Protein Name |
Lactosylceramide alpha-2,3-sialyltransferase |
Protein Accession # |
NP_003887 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003896 |
Tested Species Reactivity |
Human |
Gene Symbol |
ST3GAL5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Goat: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-ST3GAL5 Antibody Titration: 1.25ug/ml Positive Control: Jurkat cell lysate |
|
Image 2 | Human Lung Tumor, 293T Cell Lysate
| Host: Rabbit Target: ST3GAL5 Positive control (+): Human Lung Tumor (T-LU) Negative control (-): 293T Cell Lysate (2T) Antibody concentration: 0.2ug/ml |
|
Image 3 | Human kidney
| Human kidney |
|