Product Number |
ARP46375_P050 |
Product Page |
www.avivasysbio.com/dlk1-antibody-middle-region-arp46375-p050.html |
Name |
DLK1 Antibody - middle region (ARP46375_P050) |
Protein Size (# AA) |
383 amino acids |
Molecular Weight |
41kDa |
NCBI Gene Id |
8788 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Delta-like 1 homolog (Drosophila) |
Alias Symbols |
DLK, FA1, ZOG, pG2, DLK-1, PREF1, Delta1, Pref-1 |
Peptide Sequence |
Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Wermter,A.K., (er) Eur. J. Hum. Genet. (2008) In press |
Description of Target |
DLK1 may have a role in neuroendocrine differentiation. |
Protein Interactions |
GAS1; GRN; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DLK1 (ARP46375_P050) antibody |
Blocking Peptide |
For anti-DLK1 (ARP46375_P050) antibody is Catalog # AAP46375 (Previous Catalog # AAPP27159) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DLK1 |
Uniprot ID |
P80370 |
Protein Name |
Protein delta homolog 1 |
Publications |
Zhou, G. et al. Global comparison of gene expression profiles between intramuscular and subcutaneous adipocytes of neonatal landrace pig using microarray. Meat Sci. 86, 440-50 (2010). 20573458 |
Protein Accession # |
NP_003827 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003836 |
Tested Species Reactivity |
Human |
Gene Symbol |
DLK1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 100%; Sheep: 93% |
Image 1 | Human Stomach
| WB Suggested Anti-DLK1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Stomach |
|
|