| Product Number |
ARP46375_P050 |
| Product Page |
www.avivasysbio.com/dlk1-antibody-middle-region-arp46375-p050.html |
| Name |
DLK1 Antibody - middle region (ARP46375_P050) |
| Protein Size (# AA) |
383 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
8788 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Delta-like 1 homolog (Drosophila) |
| Alias Symbols |
DLK, FA1, ZOG, pG2, DLK-1, PREF1, Delta1, Pref-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wermter,A.K., (er) Eur. J. Hum. Genet. (2008) In press |
| Description of Target |
DLK1 may have a role in neuroendocrine differentiation. |
| Protein Interactions |
GAS1; GRN; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DLK1 (ARP46375_P050) antibody |
| Blocking Peptide |
For anti-DLK1 (ARP46375_P050) antibody is Catalog # AAP46375 (Previous Catalog # AAPP27159) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DLK1 |
| Uniprot ID |
P80370 |
| Protein Name |
Protein delta homolog 1 |
| Publications |
Zhou, G. et al. Global comparison of gene expression profiles between intramuscular and subcutaneous adipocytes of neonatal landrace pig using microarray. Meat Sci. 86, 440-50 (2010). 20573458 |
| Protein Accession # |
NP_003827 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003836 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DLK1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 100%; Sheep: 93% |
| Image 1 | Human Stomach
 | WB Suggested Anti-DLK1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Stomach |
|
|
