| Product Number |
ARP46365_P050 |
| Product Page |
www.avivasysbio.com/adam23-antibody-n-terminal-region-arp46365-p050.html |
| Name |
ADAM23 Antibody - N-terminal region (ARP46365_P050) |
| Protein Size (# AA) |
832 amino acids |
| Molecular Weight |
91kDa |
| NCBI Gene Id |
8745 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ADAM metallopeptidase domain 23 |
| Description |
|
| Alias Symbols |
MDC3, MDC-3 |
| Peptide Sequence |
Synthetic peptide located within the following region: SAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. It is reported that inactivation of this gene is associated with tumorigenesis in human cancers. |
| Protein Interactions |
ELAVL1; PRNP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ADAM23 (ARP46365_P050) antibody |
| Blocking Peptide |
For anti-ADAM23 (ARP46365_P050) antibody is Catalog # AAP46365 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADAM23 |
| Uniprot ID |
O75077-2 |
| Protein Name |
Disintegrin and metalloproteinase domain-containing protein 23 |
| Publications |
ADAM23 in Cardiomyocyte Inhibits Cardiac Hypertrophy by Targeting FAK - AKT Signaling. J Am Heart Assoc. 7, e008604 (2018). 30371220 |
| Protein Accession # |
NP_003803 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003812 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ADAM23 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 92%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 79% |
| Image 1 | Human HepG2
 | Host: Rabbit
Target Name: ADAM23
Sample Type: HepG2 Whole cell lysates
Antibody Dilution: 1.0ug/ml |
|
