| Product Number |
ARP46364_P050 |
| Product Page |
www.avivasysbio.com/hrk-antibody-n-terminal-region-arp46364-p050.html |
| Name |
HRK Antibody - N-terminal region (ARP46364_P050) |
| Protein Size (# AA) |
91 amino acids |
| Molecular Weight |
10kDa |
| NCBI Gene Id |
8739 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Harakiri, BCL2 interacting protein (contains only BH3 domain) |
| Alias Symbols |
DP5, HARAKIRI |
| Peptide Sequence |
Synthetic peptide located within the following region: MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Activator of apoptosis Hrk regulates apoptosis through interaction with death-repressor proteins Bcl-2 and Bcl-X(L). The HRK protein lacks significant homology to other BCL2 family members except for an 8-amino acid region that was similar to the BCL2 hom |
| Protein Interactions |
BCL2L1; ELAVL1; BAD; BCL2L2; C1QBP; BCL2A1; BCL2; MCL1; BNC1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HRK (ARP46364_P050) antibody |
| Blocking Peptide |
For anti-HRK (ARP46364_P050) antibody is Catalog # AAP46364 (Previous Catalog # AAPP27150) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HRK |
| Uniprot ID |
O00198 |
| Protein Name |
Activator of apoptosis harakiri |
| Publications |
High CIP2A levels correlate with an antiapoptotic phenotype that can be overcome by targeting BCL-XL in chronic myeloid leukemia. Leukemia. 30, 1273-81 (2016). 26987906 |
| Protein Accession # |
NP_003797 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003806 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HRK |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 83%; Rabbit: 100%; Rat: 83% |
| Image 1 | Human Thymus
 | WB Suggested Anti-HRK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus |
|
