GPAA1 Antibody - C-terminal region (ARP46363_P050)

• Product Number: ARP46363_P050
• Name: GPAA1 Antibody - C-terminal region (ARP46363_P050)
• Protein Size (# AA): 621 amino acids
• Molecular Weight: 67kDa
• NCBI Gene Id: 8733
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast)
• Alias Symbols: GAA1, hGAA1, GPIBD15
• Peptide Sequence: Synthetic peptide located within the following region: LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Vainauskas,S. (2005) J. Biol. Chem. 280 (16), 16402-16409
• Description of Target: Posttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. GPAA1 presumably functions in GPI anchoring at the GPI transfer step. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains.Posttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. The protein encoded by this gene presumably functions in GPI anchoring at the GPI transfer step. The mRNA transcript is ubiquitously expressed in both fetal and adult tissues. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains.
• Protein Interactions: UBC; PIGT; PIGU; PRR13; PIGK; EIF3E; PIN1; GRIK5; PIGS;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GPAA1 (ARP46363_P050) antibody is Catalog # AAP46363 (Previous Catalog # AAPP27149)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GPAA1
• Uniprot ID: O43292
• Protein Name: Glycosylphosphatidylinositol anchor attachment 1 protein
• Protein Accession #: NP_003792
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003801
• Tested Species Reactivity: Human
• Gene Symbol: GPAA1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%
• Image 1: Human kidney
  
  Human kidney
• Image 2: Human HepG2
  
  WB Suggested Anti-GPAA1 Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate
• Image 3: Human Liver Tissue
  
  GPAA1 antibody - C-terminal region (ARP46363_P050)
  Catalog Number: ARP46363_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
  Observed Staining: Cytoplasm in sinusoids of liver
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 4: Human Lung Tissue
  
  GPAA1 antibody - C-terminal region (ARP46363_P050)
  Catalog Number: ARP46363_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
  Observed Staining: Cytoplasm of pneumocytes
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec