LMNB2 Antibody - N-terminal region (ARP46356_P050)

• Product Number: ARP46356_P050
• Name: LMNB2 Antibody - N-terminal region (ARP46356_P050)
• Protein Size (# AA): 600 amino acids
• Molecular Weight: 68kDa
• NCBI Gene Id: 84823
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Lamin B2
• Alias Symbols: EPM9, LMN2, LAMB2, MCPH27
• Peptide Sequence: Synthetic peptide located within the following region: MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Tsai,M.Y., (2006) Science 311 (5769), 1887-1893
• Description of Target: The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. LMNB2 is one of the two B type proteins, B2.The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B2. This gene is in a head-to-tail orientation with the gene for the translocase of inner mitochondrial membrane 13 homolog gene.
• Protein Interactions: UBC; GPRASP2; SUZ12; EED; RNF2; LMNA; PAN2; VCP; UBD; SIRT7; ELAVL1; SVIL; BANF1; PRKCD; LMNB2; TMPO; XRCC5; ORC2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-LMNB2 (ARP46356_P050) antibody is Catalog # AAP46356 (Previous Catalog # AAPP27142)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LMNB2
• Uniprot ID: Q03252
• Protein Name: Lamin-B2
• Publications:

  The nucleoporin Nup153 regulates embryonic stem cell pluripotency through gene silencing. Genes Dev. 29, 1224-38 (2015). 26080816

• Sample Type Confirmation:

  LMNB2 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_116126
• Purification: Affinity Purified
• Nucleotide Accession #: NM_032737
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: LMNB2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 92%
• Image 1: Human Jurkat
  
  WB Suggested Anti-LMNB2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysateLMNB2 is supported by BioGPS gene expression data to be expressed in Jurkat
• Image 2: Mouse C2C12 cells
  
  Researcher: Dr. David Razafsky, Washington University in Saint Louis
  Application: IHC
  Species + Tissue/Cell type: Mouse C2C12 cells
  Primary antibody dilution: 1:500
  Secondary antibody: Goat anti-rabbit-Alexa Fluor 488
  Secondary antibody dilution: 1:500