WBP11 Antibody - N-terminal region (ARP46241_P050)

• Product Number: ARP46241_P050
• Name: WBP11 Antibody - N-terminal region (ARP46241_P050)
• Protein Size (# AA): 641 amino acids
• Molecular Weight: 70kDa
• NCBI Gene Id: 51729
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: WW domain binding protein 11
• Alias Symbols: BUG13, FAP90, NPWBP, SIPP1, VCTRL, CFAP90, VCTERL, WBP-11, PPP1R165
• Peptide Sequence: Synthetic peptide located within the following region: GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648
• Description of Target: WBP11 is a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. WBP11has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.This gene encodes a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. This protein has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.
• Protein Interactions: TESC; TRAF4; GRB2; FYN; UBC; BMI1; APBB1; WBP4; HECW2; DDX17; RBM5; PPP1CA; DDX5; CTNNBL1; PPP1CC; UPF3B; ZC3H13; CPSF6; SNRPB2; PQBP1; CD2BP2; SF3A2; ITSN1; RTN4IP1; PPP1CB; GIGYF2; MCRS1; PRPF40A; C5orf22; NCK2; TRIP10; NCF1; VIM; SRC; PIK3R1; RUNX1T1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Other Applications Image 1 Data: IP Suggested Anti-WBP11 antibody
  Titration: 2 ug/ml
  Positive Control: Mouse brain homogenate
  
• Blocking Peptide: For anti-WBP11 (ARP46241_P050) antibody is Catalog # AAP46241 (Previous Catalog # AAPP27073)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WBP11
• Uniprot ID: Q9Y2W2
• Protein Name: WW domain-binding protein 11
• Sample Type Confirmation:

  WBP11 is strongly supported by BioGPS gene expression data to be expressed in HeLa, Jurkat

• Protein Accession #: NP_057396
• Purification: Affinity Purified
• Nucleotide Accession #: NM_016312
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: WBP11
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, IP, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human HeLa
  
  WB Suggested Anti-WBP11 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: Hela cell lysateWBP11 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells
• Image 2: Human Jurkat
  
  Host: Rabbit
  Target Name: WBP11
  Sample Type: Jurkat
  Antibody Dilution: 1.0ug/mlWBP11 is strongly supported by BioGPS gene expression data to be expressed in Jurkat
• Image 3: Human NT-2, Mouse WT brain extract
  
  Lanes:
  1. Human NT-2 cells (60ug) lysate 2. Mouse WT brain extract (80ug)
  Primary Antibody Dilution:
  2ug/ml
  Secondary Antibody:
  IRDye 800CW goat anti-rabbit from Li-COR Bioscience
  Secondary Antibody Dilution:
  1: 20,000
  Gene Name:
  WBP11
  Submitted by:
  Dr. Yuzhi Chen, University of Arkansas for Medical Science
  
• Image 4: Mouse brain
  
  Amount and Sample Type:
  500 ug mouse brain homogenate
  Amount of IP Antibody:
  6 ug
  Primary Antibody:
  WBP11
  Primary Antibody Dilution:
  1:500
  Secondary Antibody:
  Goat anti-rabbit Alexa-Fluor 594
  Secondary Antibody Dilution:
  1:5000
  Gene Name:
  WBP11
  Submitted by:
  Dr. Yuzhi Chen, University of Arkansas for Medical Science
• Image 5: Human Pineal Tissue
  
  Rabbit Anti-WBP11 Antibody
  Catalog Number: ARP46241_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
  Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec