| Product Number |
ARP46132_P050 |
| Product Page |
www.avivasysbio.com/bcat1-antibody-n-terminal-region-arp46132-p050.html |
| Name |
BCAT1 Antibody - N-terminal region (ARP46132_P050) |
| Protein Size (# AA) |
386 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
586 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Branched chain amino-acid transaminase 1, cytosolic |
| Description |
|
| Alias Symbols |
BCT1, PP18, BCATC, ECA39, MECA39, PNAS121 |
| Peptide Sequence |
Synthetic peptide located within the following region: MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Conway,M.E., (2008) Biochemistry 47 (19), 5465-5479 |
| Description of Target |
This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth. Two different clin |
| Protein Interactions |
UBC; GTF2F1; AGL; PUS1; DUS3L; PRMT6; KDM1A; SNF8; PSAP; SERPINE2; SMAD5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-BCAT1 (ARP46132_P050) antibody |
| Blocking Peptide |
For anti-BCAT1 (ARP46132_P050) antibody is Catalog # AAP46132 (Previous Catalog # AAPP26994) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human BCAT1 |
| Uniprot ID |
P54687 |
| Protein Name |
Branched-chain-amino-acid aminotransferase, cytosolic |
| Protein Accession # |
NP_005495 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005504 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BCAT1 |
| Predicted Species Reactivity |
Human, Mouse, Dog, Horse, Pig, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Horse: 92%; Human: 100%; Mouse: 85%; Pig: 85%; Rabbit: 100%; Sheep: 92% |
| Image 1 | Human Small Intestine
 | WB Suggested Anti-BCAT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Small Intestine |
|
