PPAT Antibody - N-terminal region (ARP46079_P050)

Data Sheet
 
Product Number ARP46079_P050
Product Page www.avivasysbio.com/ppat-antibody-n-terminal-region-arp46079-p050.html
Name PPAT Antibody - N-terminal region (ARP46079_P050)
Protein Size (# AA) 517 amino acids
Molecular Weight 57 kDa
NCBI Gene Id 5471
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Phosphoribosyl pyrophosphate amidotransferase
Alias Symbols GPAT, PRAT, ATASE
Peptide Sequence Synthetic peptide located within the following region: VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Bera,A.K., (1999) J. Biol. Chem. 274 (51), 36498-36504
Description of Target PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. This gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.
Protein Interactions FAM96B; CIAO1; FAM114A1; PARVA; CARM1; RANBP3; TROVE2; RSU1; MEA1; ILK; HSPA4; GART; CARS; MMS19; EPT1; ATXN1; SMURF1; MCM3; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-PPAT (ARP46079_P050) antibody
Additional Information IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%.
Blocking Peptide For anti-PPAT (ARP46079_P050) antibody is Catalog # AAP46079 (Previous Catalog # AAPS17401)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PPAT
Uniprot ID Q06203
Protein Name Amidophosphoribosyltransferase
Sample Type Confirmation

PPAT is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_002694
Purification Affinity Purified
Nucleotide Accession # NM_002703
Tested Species Reactivity Human
Gene Symbol PPAT
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rabbit: 93%; Rat: 79%
Image 1
Human kidney
Human kidney
Image 2
Human, Hamster
Sample Type: 1. Human Skin Fibroblasts (100ug)
2. HepG2 cells (20ug)
3. HEK273 cells (20ug)
4. HeLa skin cells(20ug)
5. Hamster CHO K1 cells (20ug)
Primary Dilution: 1:5000
Secondary Antibody: Clean-Blot IP detection Reagent and Kit
Secondary Dilution: 1:2000
Image Submitted By: V. Skopova, M. Zikanova
Institute of Inherited Metabolic Disorders, Charles University in Prague and General Hopspital in Prague 

Image 3

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com