| Product Number |
ARP46077_P050 |
| Product Page |
www.avivasysbio.com/mx1-antibody-c-terminal-region-arp46077-p050.html |
| Name |
MX1 Antibody - C-terminal region (ARP46077_P050) |
| Protein Size (# AA) |
662 amino acids |
| Molecular Weight |
75kDa |
| NCBI Gene Id |
4599 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse) |
| Alias Symbols |
MX, MxA, IFI78, IFI-78K, lncMX1-215 |
| Peptide Sequence |
Synthetic peptide located within the following region: KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hoenen,A., J. Gen. Virol. 88 (PT 11), 3013-3017 (2007) |
| Description of Target |
In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. MX1 is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. The protein encoded by this gene is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
MX1; CAB39L; SIAH1; UBC; APP; ISG15; TRPC7; TRPC3; TRPC1; TRPC4; BLM; TRPC6; DAXX; TRPC5; TUBB; ACTB; PIAS1; SUMO1; SP100; FANCA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MX1 (ARP46077_P050) antibody |
| Blocking Peptide |
For anti-MX1 (ARP46077_P050) antibody is Catalog # AAP46077 (Previous Catalog # AAPS17311) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human MX1 |
| Uniprot ID |
P20591 |
| Protein Name |
Interferon-induced GTP-binding protein Mx1 |
| Publications |
Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828 |
| Protein Accession # |
NP_002453 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002462 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MX1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 93%; Sheep: 86% |
| Image 1 | Human Heart
 | Rabbit Anti-MX1 antibody
Catalog Number: ARP46077
Formalin Fixed Paraffin Embedded Tissue: Human Heart
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec |
|
| Image 2 | human LCL
 | MX1 antibody - C-terminal region (ARP46077_P050) validated by WB using human LCL at 1:1000. |
|
| Image 3 | Human 786-0
 | Host: Rabbit
Target Name: MX1
Sample Tissue: Human 786-0
Antibody Dilution: 1.0ug/ml |
|
