DUT Antibody - C-terminal region (ARP46027_T100)

• Product Number: ARP46027_T100
• Name: DUT Antibody - C-terminal region (ARP46027_T100)
• Protein Size (# AA): 252 amino acids
• Molecular Weight: 19kDa
• NCBI Gene Id: 1854
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Deoxyuridine triphosphatase
• Alias Symbols: dUTPase
• Peptide Sequence: Synthetic peptide located within the following region: NFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Studebaker,A.W., (2005) Biochem. Biophys. Res. Commun. 327 (1), 306-310
• Description of Target: DUT is an essential enzyme of nucleotide metabolism. This protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death.This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19.
• Protein Interactions: GDI2; NUDT18; PLEKHF2; C19orf25; MRPL14; LEMD3; UBL4A; RPL38; UBC; CUL3; ESRRG; ESRRA; ESR1; SPATA2; DUT; PPARD; PPARA; CDK1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Jurkat cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 15%.
• Blocking Peptide: For anti-DUT (ARP46027_T100) antibody is Catalog # AAP46027 (Previous Catalog # AAPP26870)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DUT
• Uniprot ID: P33316
• Protein Name: Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
• Sample Type Confirmation:

  DUT is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_001020419
• Purification: Protein A purified
• Nucleotide Accession #: NM_001025248
• Tested Species Reactivity: Human
• Gene Symbol: DUT
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 93%; Zebrafish: 86%
• Image 1: Human Heart
  
  Human Heart
• Image 2: Human Jurkat
  
  WB Suggested Antibody Titration: 2.5ug/ml
  Positive Control: JurkatDUT is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells