Product Number |
ARP45912_P050 |
Product Page |
www.avivasysbio.com/c21orf13-antibody-n-terminal-region-arp45912-p050.html |
Name |
C21orf13 Antibody - N-terminal region (ARP45912_P050) |
Protein Size (# AA) |
670 amino acids |
Molecular Weight |
76kDa |
NCBI Gene Id |
150082 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Leber congenital amaurosis 5-like |
Alias Symbols |
C21orf13 |
Peptide Sequence |
Synthetic peptide located within the following region: SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
den (2007) Nat. Genet. 39 (7), 889-895 |
Description of Target |
The function of the C21orf13 protein remains unknown. |
Protein Interactions |
TFIP11; NMI; TPM3; SUV39H2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LCA5L (ARP45912_P050) antibody |
Blocking Peptide |
For anti-LCA5L (ARP45912_P050) antibody is Catalog # AAP45912 (Previous Catalog # AAPS16510) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf13 |
Uniprot ID |
O95447 |
Protein Name |
Lebercilin-like protein |
Publications |
Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828 |
Protein Accession # |
NP_689718 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_152505 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
LCA5L |
Predicted Species Reactivity |
Human, Yeast |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Yeast: 75% |
Image 1 | Human MCF7
| WB Suggested Anti-C21orf13 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: MCF7 cell lysate |
| Image 2 | Mouse Brain
| WB Suggested Anti-C21orf13 Antibody Titration: 5% Milk ELISA Titer: dilution: 1:500 Positive Control: Mouse Brain lysate |
|
|