C21orf13 Antibody - N-terminal region (ARP45912_P050)

Data Sheet
 
Product Number ARP45912_P050
Product Page www.avivasysbio.com/c21orf13-antibody-n-terminal-region-arp45912-p050.html
Name C21orf13 Antibody - N-terminal region (ARP45912_P050)
Protein Size (# AA) 670 amino acids
Molecular Weight 76kDa
NCBI Gene Id 150082
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Leber congenital amaurosis 5-like
Alias Symbols C21orf13
Peptide Sequence Synthetic peptide located within the following region: SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference den (2007) Nat. Genet. 39 (7), 889-895
Description of Target The function of the C21orf13 protein remains unknown.
Protein Interactions TFIP11; NMI; TPM3; SUV39H2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LCA5L (ARP45912_P050) antibody
Blocking Peptide For anti-LCA5L (ARP45912_P050) antibody is Catalog # AAP45912 (Previous Catalog # AAPS16510)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf13
Uniprot ID O95447
Protein Name Lebercilin-like protein
Publications

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828

Protein Accession # NP_689718
Purification Affinity Purified
Nucleotide Accession # NM_152505
Tested Species Reactivity Human, Mouse
Gene Symbol LCA5L
Predicted Species Reactivity Human, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Yeast: 75%
Image 1
Human MCF7
WB Suggested Anti-C21orf13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate
Image 2
Mouse Brain
WB Suggested Anti-C21orf13 Antibody Titration: 5% Milk
ELISA Titer: dilution: 1:500
Positive Control: Mouse Brain lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com