| Product Number |
ARP45911_P050 |
| Product Page |
www.avivasysbio.com/c21orf13-antibody-middle-region-arp45911-p050.html |
| Name |
C21orf13 Antibody - middle region (ARP45911_P050) |
| Protein Size (# AA) |
670 amino acids |
| Molecular Weight |
76kDa |
| NCBI Gene Id |
150082 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Leber congenital amaurosis 5-like |
| Alias Symbols |
C21orf13 |
| Peptide Sequence |
Synthetic peptide located within the following region: GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSSPTEGKRKIII |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
den (2007) Nat. Genet. 39 (7), 889-895 |
| Description of Target |
The function of the C21orf13 protein remains unknown. |
| Protein Interactions |
TFIP11; NMI; TPM3; SUV39H2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LCA5L (ARP45911_P050) antibody |
| Blocking Peptide |
For anti-LCA5L (ARP45911_P050) antibody is Catalog # AAP45911 (Previous Catalog # AAPS16509) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C21orf13 |
| Uniprot ID |
O95447 |
| Protein Name |
Lebercilin-like protein |
| Protein Accession # |
NP_689718 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152505 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LCA5L |
| Predicted Species Reactivity |
Human, Cow, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Horse: 86%; Human: 100%; Pig: 93% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-C21orf13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate |
|
|
