| Product Number |
ARP45862_P050 |
| Product Page |
www.avivasysbio.com/donson-antibody-middle-region-arp45862-p050.html |
| Name |
DONSON Antibody - middle region (ARP45862_P050) |
| Protein Size (# AA) |
566 amino acids |
| Molecular Weight |
63kDa |
| NCBI Gene Id |
29980 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Downstream neighbor of SON |
| Description |
|
| Alias Symbols |
B17, MIMIS, MISSLA, C21orf60 |
| Peptide Sequence |
Synthetic peptide located within the following region: DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gardiner,K., (2002) Genomics 79 (6), 833-843 |
| Description of Target |
This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown. |
| Protein Interactions |
UBC; PSMA3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DONSON (ARP45862_P050) antibody |
| Blocking Peptide |
For anti-DONSON (ARP45862_P050) antibody is Catalog # AAP45862 (Previous Catalog # AAPP26790) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DONSON |
| Uniprot ID |
Q9NYP3 |
| Protein Name |
Protein downstream neighbor of Son |
| Publications |
Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828
The GABAAα5-selective Modulator, RO4938581, Rescues Protein Anomalies in the Ts65Dn Mouse Model of Down Syndrome. Neuroscience. 372, 192-212 (2018) 29292072 |
| Sample Type Confirmation |
DONSON is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_060083 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_017613 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
DONSON |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-DONSON Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysateDONSON is supported by BioGPS gene expression data to be expressed in HepG2 |
|
| Image 2 | Mouse brains
 | DONSON antibody - middle region (ARP45862_P050) validated by WB using Mouse brains at 1:1000. |
|
