PDE9A Antibody (ARP45760_P050)

• Product Number: ARP45760_P050
• Name: PDE9A Antibody (ARP45760_P050)
• Protein Size (# AA): 526 amino acids
• Molecular Weight: 61kDa
• NCBI Gene Id: 5152
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Phosphodiesterase 9A
• Alias Symbols: HSPDE9A2
• Peptide Sequence: Synthetic peptide located within the following region: SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Huai,Q., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (26), 9624-9629
• Description of Target: PDE9A catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides.The protein encoded by this gene catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The encoded protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides. Multiple transcript variants encoding several different isoforms have been found for this gene.
• Protein Interactions: NAA38; UTP23; KRTAP9-2; TRPV6; GORASP2; TRIM32; BAG3; LAGE3; SULT1E1; PDE9A; LMO2; CRY2; CLK1; C9orf106; NOTCH2NL; KRTAP10-3; KRTAP10-8; KRTAP4-2; PHYHIPL;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Jurkat cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 12%.
• Blocking Peptide: For anti-PDE9A (ARP45760_P050) antibody is Catalog # AAP45760 (Previous Catalog # AAPP26712)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDE9A
• Uniprot ID: O76083-13
• Protein Name: High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
• Protein Accession #: NP_001001581
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001001581
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: PDE9A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 92%
• Image 1: Human Jurkat
  
  WB Suggested Anti-PDE9A Antibody Titration: 1.0 ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Mouse Brain
  
  WB Suggested Anti-PDE9A Antibody Titration: 5% Milk
  ELISA Titer: dilution: 1:500
  Positive Control: Mouse Brain lysate
• Image 3: Human kidney
  
  Human kidney
• Image 4: HEK293
  
  Sample Type:
  Lane 1: 5ug in vitro translation without DNA Lane 2: 5ug in vitro translation hNeur1-pcDNA3 Lane 3: 60ug in vitro translation rNeur1-pcDNA3 Lane 4: 60ug HEK293 cell lysate (not transfected) Lane 5: 60ug hNeur1-pcDNA3 overexpressed in HEK293 cells Lane 6: 60ug rNeur1-pcDNA3 overexpressed in HEK293 cells Primary Antibody Dilution:
  1:1000 Secondary Antibody:
  Anti-rabbit-HRP Secondary Antibody Dilution:
  1:5000 Color/Signal Descriptions:
  PDE9A Gene Name:
  Kati Taal and Richard Tamme, Department of Gene Technology, Tallinn University of Technology. Submitted by:
  
• Image 5: Human Hela Whole Cell
  
  Host: Rabbit
  Target Name: PDE9A
  Sample Tissue: Human Hela Whole Cell
  Antibody Dilution: 1ug/ml