HSD11B1 Antibody - N-terminal region (ARP45714_P050)

• Product Number: ARP45714_P050
• Name: HSD11B1 Antibody - N-terminal region (ARP45714_P050)
• Protein Size (# AA): 292 amino acids
• Molecular Weight: 32kDa
• NCBI Gene Id: 3290
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Hydroxysteroid (11-beta) dehydrogenase 1
• Alias Symbols: HDL, 11-DH, HSD11, HSD11B, HSD11L, CORTRD2, SDR26C1, 11-beta-HSD1
• Peptide Sequence: Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Paulsen,S.K., (2008) Obesity (Silver Spring) 16 (4), 731-735
• Description of Target: HSD11B1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, HSD11B1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children.The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene.
• Protein Interactions: GKAP1; CD36;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Western analysis of fetal liver lysate.
• Blocking Peptide: For anti-HSD11B1 (ARP45714_P050) antibody is Catalog # AAP45714 (Previous Catalog # AAPP11847)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSD11B1
• Uniprot ID: P28845
• Protein Name: Corticosteroid 11-beta-dehydrogenase isozyme 1
• Publications:

  Kuroda, K. et al. Induction of 11beta-HSD 1 and activation of distinct mineralocorticoid receptor- and glucocorticoid receptor-dependent gene networks in decidualizing human endometrial stromal cells. Mol. Endocrinol. 27, 192-202 (2013). 23275455

  Lei, K. et al. Progesterone acts via the nuclear glucocorticoid receptor to suppress IL-1beta-induced COX-2 expression in human term myometrial cells. PLoS One 7, e50167 (2012). 23209664

• Protein Accession #: NP_005516
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005525
• Tested Species Reactivity: Human, Rat
• Gene Symbol: HSD11B1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%
• Image 1: Rodent Rat Testis
  
  Host: Rabbit
  Target Name: HSD11B1
  Sample Tissue: Rodent Rat Testis
  Antibody Dilution: 2ug/ml
• Image 2: Human Placenta, Human cerebral cortex
  
  Host: Rabbit
  Target: HSD11B1
  Positive control (+): Human Placenta (PL)
  Negative control (-): Human cerebral cortex
  Antibody concentration: 1ug/ml
• Image 3: Human Liver
  
  Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-HSD11B1 antibody (ARP45714_P050)
• Image 4: Rat Liver
  
  Host: Rat
  Target Name: HSD11B1
  Sample Tissue: Rat Liver
  Antibody Dilution: 1ug/ml
• Image 5: Transient overexpression lysate of HSD11B1 and Non-overexpressed vector control lysate
  
  WB Suggested Anti-HSD11B1 Antibody Titration: 2 ug/ml
  Positive Control: Transient overexpression lysate of HSD11B1 and Non-overexpressed vector control lysate
• Image 6:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/mL. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.