GLUD1 Antibody - N-terminal region (ARP45708_P050)

• Product Number: ARP45708_P050
• Name: GLUD1 Antibody - N-terminal region (ARP45708_P050)
• Protein Size (# AA): 558 amino acids
• Molecular Weight: 56kDa
• NCBI Gene Id: 2746
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Glutamate dehydrogenase 1
• Alias Symbols: GDH, GDH1, GLUD
• Peptide Sequence: Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kawajiri,M., (2006) Pediatr. Res. 59 (3), 359-364
• Description of Target: L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification. L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate (Smith et al., 2001 [PubMed 11254391]). Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification (Mavrothalassitis et al., 1988 [PubMed 3368458]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-51 M20867.1 1-51 52-3120 BC112946.1 16-3084
• Protein Interactions: FUS; UBC; DCP2; KLHL29; SUMO1; NEDD8; LSM1; ILK; CDK5; VTN; SEC62; STAT5A; ORM1; HPX; NR4A1; FN1; CRP; ASGR2; CUL3; ELAVL1; EBNA-LP; HDAC5; ICT1; GLUD1; DYNLL1; GOT2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Blocking Peptide: For anti-GLUD1 (ARP45708_P050) antibody is Catalog # AAP45708 (Previous Catalog # AAPP11841)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD1
• Uniprot ID: P00367
• Protein Name: Glutamate dehydrogenase 1, mitochondrial
• Sample Type Confirmation:

  GLUD1 is strongly supported by BioGPS gene expression data to be expressed in HT1080

• Protein Accession #: NP_005262
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005271
• Tested Species Reactivity: Human, Rat
• Gene Symbol: GLUD1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Sheep, Yeast, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 100%; Sheep: 86%; Yeast: 86%; Zebrafish: 83%
• Image 1: Human HT1080
  
  GLUD1 antibody - N-terminal region (ARP45708_P050) validated by WB using HT1080 cell lysate at 1ug/ml.GLUD1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells
• Image 2: Rat
  
  lanes 5: rat kidney cordex
  lanes 6: rat kidney proximal tubules prepped from cortex
  lanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysate
  lanes 8: rat brain supernatant
• Image 3: Human Colon
  
  Immunohistochemistry with PFA fixed human colon tissue tissue
• Image 4: Human Kidney
  
  Immunohistochemistry with CORTEX/KIDNEY tissue
• Image 5: Human Pancreas
  
  Immunohistochemistry with pFA fixed human pancreas tissue tissue