BAAT Antibody - N-terminal region (ARP45686_P050)

Data Sheet
 
Product Number ARP45686_P050
Product Page www.avivasysbio.com/baat-antibody-n-terminal-region-arp45686-p050.html
Name BAAT Antibody - N-terminal region (ARP45686_P050)
Protein Size (# AA) 418 amino acids
Molecular Weight 46 kDa
NCBI Gene Id 570
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase)
Alias Symbols BAT, HCHO, BACAT, BACD1
Peptide Sequence Synthetic peptide located within the following region: IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tougou,K., (2007) Drug Metab. Pharmacokinet. 22 (2), 125-128
Description of Target BAAT is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene.
Protein Interactions GOLGA8F; GOLGA8EP; GOLGA8DP; PEX5; SLC7A11;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-BAAT (ARP45686_P050) antibody
Blocking Peptide For anti-BAAT (ARP45686_P050) antibody is Catalog # AAP45686 (Previous Catalog # AAPP26691)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BAAT
Uniprot ID Q14032
Protein Name Bile acid-CoA:amino acid N-acyltransferase
Publications

Aleksunes, L. M., Yeager, R. L., Wen, X., Cui, J. Y. & Klaassen, C. D. Repression of hepatobiliary transporters and differential regulation of classic and alternative bile acid pathways in mice during pregnancy. Toxicol. Sci. 130, 257-68 (2012). 22903823

Protein Accession # NP_001692
Purification Affinity Purified
Nucleotide Accession # NM_001701
Tested Species Reactivity Human
Gene Symbol BAAT
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Image 1
Human Liver
WB Suggested Anti-BAAT Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver
Image 2
Human Liver
Rabbit Anti-BAAT antibody
Catalog Number: ARP45686
Formalin Fixed Paraffin Embedded Tissue: Human Liver
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
Image 3

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com