Product Number |
ARP45686_P050 |
Product Page |
www.avivasysbio.com/baat-antibody-n-terminal-region-arp45686-p050.html |
Name |
BAAT Antibody - N-terminal region (ARP45686_P050) |
Protein Size (# AA) |
418 amino acids |
Molecular Weight |
46 kDa |
NCBI Gene Id |
570 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase) |
Alias Symbols |
BAT, HCHO, BACAT, BACD1 |
Peptide Sequence |
Synthetic peptide located within the following region: IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Tougou,K., (2007) Drug Metab. Pharmacokinet. 22 (2), 125-128 |
Description of Target |
BAAT is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene. |
Protein Interactions |
GOLGA8F; GOLGA8EP; GOLGA8DP; PEX5; SLC7A11; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-BAAT (ARP45686_P050) antibody |
Blocking Peptide |
For anti-BAAT (ARP45686_P050) antibody is Catalog # AAP45686 (Previous Catalog # AAPP26691) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human BAAT |
Uniprot ID |
Q14032 |
Protein Name |
Bile acid-CoA:amino acid N-acyltransferase |
Publications |
Aleksunes, L. M., Yeager, R. L., Wen, X., Cui, J. Y. & Klaassen, C. D. Repression of hepatobiliary transporters and differential regulation of classic and alternative bile acid pathways in mice during pregnancy. Toxicol. Sci. 130, 257-68 (2012). 22903823 |
Protein Accession # |
NP_001692 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001701 |
Tested Species Reactivity |
Human |
Gene Symbol |
BAAT |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93% |
Image 1 | Human Liver
| WB Suggested Anti-BAAT Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Liver |
|
Image 2 | Human Liver
| Rabbit Anti-BAAT antibody Catalog Number: ARP45686 Formalin Fixed Paraffin Embedded Tissue: Human Liver Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec
|
|
Image 3 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
|
|