IGFBP4 Antibody - middle region (ARP45685_P050)

• Product Number: ARP45685_P050
• Name: IGFBP4 Antibody - middle region (ARP45685_P050)
• Protein Size (# AA): 258 amino acids
• Molecular Weight: 28kDa
• NCBI Gene Id: 3487
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Insulin-like growth factor binding protein 4
• Alias Symbols: BP-4, IBP4, IGFBP-4, HT29-IGFBP
• Peptide Sequence: Synthetic peptide located within the following region: RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Durai,R., (2007) Colorectal Dis 9 (7), 625-631
• Description of Target: IGFBP4 is a member of the insulin-like growth factor binding protein (IGFBP) family. IGFBP4 is a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: KDM1A; SUV39H1; Hk3; Hk2; TF; PAPPA; IGF2; IGF1; CTSD;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Placenta, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Placenta, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Blocking Peptide: For anti-IGFBP4 (ARP45685_P050) antibody is Catalog # AAP45685 (Previous Catalog # AAPP25834)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IGFBP4
• Uniprot ID: P22692
• Protein Name: Insulin-like growth factor-binding protein 4
• Publications:

  Shi, Z., Chiang, C.-I., Mistretta, T.-A., Major, A. & Mori-Akiyama, Y. SOX9 directly regulates IGFBP-4 in the intestinal epithelium. Am. J. Physiol. Gastrointest. Liver Physiol. 305, G74-83 (2013). 23660500

• Protein Accession #: NP_001543
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001552
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: IGFBP4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Image 1: Human MDA-MB-435s Whole Cell
  
  Host: Rabbit
  Target Name: IGFBP4
  Sample Tissue: Human MDA-MB-435s Whole Cell
  Antibody Dilution: 1ug/ml
• Image 2: Human Prostate
  
  Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-IGFBP4 antibody (ARP45685_P050)
• Image 3: Human Fetal Brain
  
  WB Suggested Anti-IGFBP4 Antibody Titration: 1 ug/ml
  Positive Control: Fetal Brain Lysate
• Image 4: Mouse Brain
  
  Host: Mouse
  Target Name: IGFBP4
  Sample Tissue: Mouse Brain
  Antibody Dilution: 1ug/ml
• Image 5: Human HT1080 Whole Cell
  
  Host: Rabbit
  Target Name: IGFBP4
  Sample Tissue: Human HT1080 Whole Cell
  Antibody Dilution: 1ug/ml