MBL2 Antibody - middle region (ARP45676_P050)

Data Sheet
 
Product Number ARP45676_P050
Product Page www.avivasysbio.com/mbl2-antibody-middle-region-arp45676-p050.html
Name MBL2 Antibody - middle region (ARP45676_P050)
Protein Size (# AA) 248 amino acids
Molecular Weight 24
NCBI Gene Id 4153
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Mannose-binding lectin (protein C) 2, soluble
Alias Symbols MBL, MBP, MBP1, MBPD, MBL2D, MBP-C, COLEC1, HSMBPC
Peptide Sequence Synthetic peptide located within the following region: KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.
Protein Interactions MASP2; MAD2L1; MASP1; MBL2; PTPRC; KRT1; CD93; CALCR; CALR;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MBL2 (ARP45676_P050) antibody
Blocking Peptide For anti-MBL2 (ARP45676_P050) antibody is Catalog # AAP45676 (Previous Catalog # AAPP26688)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MBL2
Uniprot ID Q66S64
Protein Name Mannose-binding protein C
Protein Accession # NP_000233
Purification Affinity Purified
Nucleotide Accession # NM_000242
Tested Species Reactivity Human
Gene Symbol MBL2
Predicted Species Reactivity Human, Rat, Cow, Goat, Horse, Pig, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 77%; Goat: 77%; Horse: 92%; Human: 100%; Pig: 92%; Rat: 77%; Sheep: 77%
Image 1
Human HeLa
WB Suggested Anti-MBL2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com