| Product Number |
ARP45672_T100-Biotin |
| Product Page |
www.avivasysbio.com/arg1-antibody-n-terminal-region-biotin-arp45672-t100-biotin.html |
| Name |
ARG1 Antibody - N-terminal region : Biotin (ARP45672_T100-Biotin) |
| Protein Size (# AA) |
322 amino acids |
| Molecular Weight |
35kDa |
| Conjugation |
Biotin |
| NCBI Gene Id |
383 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Arginase, liver |
| Peptide Sequence |
Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Orellana,M.S., (2002) Arch. Biochem. Biophys. 403 (2), 155-159 |
| Description of Target |
Arginase catalyzes the hydrolysis of arginine to ornithine and urea. The type I isoform of ARG1, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia. |
| Protein Interactions |
RPA3; RPA2; RPA1; SUZ12; EZH2; BMI1; ALDH4A1; ESR1; RAD21; UBC; UCHL5; ATG101; USP53; FLOT1; NOS1; ARG2; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-ARG1 (ARP45672_T100-Biotin) antibody |
| Additional Information |
IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-ARG1 (ARP45672_T100-Biotin) antibody is Catalog # AAP45672 (Previous Catalog # AAPP25826) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ARG1 |
| Uniprot ID |
P05089 |
| Protein Name |
Arginase-1 |
| Publications |
Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Goat, Dog, Horse, Human, Rat, Bovine, Pig, Guinea pig, Mouse, Rabbit 24465277 |
| Protein Accession # |
NP_000036 |
| Nucleotide Accession # |
NM_000045 |
| Gene Symbol |
ARG1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 100% |
| Image 1 | |
|
