NR2E1 Antibody - middle region (ARP45612_P050)

Data Sheet
 
Product Number ARP45612_P050
Product Page www.avivasysbio.com/nr2e1-antibody-middle-region-arp45612-p050.html
Name NR2E1 Antibody - middle region (ARP45612_P050)
Protein Size (# AA) 385 amino acids
Molecular Weight 42kDa
NCBI Gene Id 7101
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nuclear receptor subfamily 2, group E, member 1
Alias Symbols TLL, TLX, XTLL
Peptide Sequence Synthetic peptide located within the following region: LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kumar,R.A., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press
Description of Target The NR2E1 gene is a member of the steroid nuclear receptor superfamily and is predominately expressed in the brain. The contributions of this gene to human B-cell leukemia and to brain development are unknown at present.
Protein Interactions NSD1; BCL11A; UBC; ERBB2IP; SP1; HDAC7; HDAC5; HDAC3; GSE1; RCOR1; KDM1A; ZMYM2; HDAC2; HDAC1; Gug; ATN1; RERE;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NR2E1 (ARP45612_P050) antibody
Blocking Peptide For anti-NR2E1 (ARP45612_P050) antibody is Catalog # AAP45612 (Previous Catalog # AAPP11891)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NR2E1
Uniprot ID Q64104
Protein Name Nuclear receptor subfamily 2 group E member 1
Protein Accession # NP_003260
Purification Affinity Purified
Nucleotide Accession # NM_003269
Tested Species Reactivity Human
Gene Symbol NR2E1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HepG2
WB Suggested Anti-NR2E1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com