Product Number |
ARP45501_P050 |
Product Page |
www.avivasysbio.com/degs1-antibody-n-terminal-region-arp45501-p050.html |
Name |
DEGS1 Antibody - N-terminal region (ARP45501_P050) |
Protein Size (# AA) |
323 amino acids |
Molecular Weight |
38 kDa |
NCBI Gene Id |
8560 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Delta(4)-desaturase, sphingolipid 1 |
Alias Symbols |
MLD, DEGS, DES1, Des-1, FADS7, HLD18, MIG15, DEGS-1 |
Peptide Sequence |
Synthetic peptide located within the following region: GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kraveka,J.M., (2007) J. Biol. Chem. 282 (23), 16718-16728 |
Description of Target |
DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this protein inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor.This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified. |
Protein Interactions |
UBC; NAGPA; UBD; EGFR; TSSC1; SURF4; SLC16A1; PYGM; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-DEGS1 (ARP45501_P050) antibody |
Blocking Peptide |
For anti-DEGS1 (ARP45501_P050) antibody is Catalog # AAP45501 (Previous Catalog # AAPP26566) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DEGS1 |
Uniprot ID |
O15121 |
Protein Name |
Sphingolipid delta(4)-desaturase DES1 |
Protein Accession # |
NP_003667 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003676 |
Tested Species Reactivity |
Human |
Gene Symbol |
DEGS1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%; Zebrafish: 93% |
Image 1 | 293T, MCF7
| Host: Rabbit Target: DEGS1 Positive control (+): 293T (2T) Negative control (-): MCF7 (N10) Antibody concentration: 1ug/ml |
|
Image 2 | Human Muscle
| WB Suggested Anti-DEGS1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle |
|
Image 3 | Human Lung Tissue
| DEGS1 antibody - N-terminal region (ARP45501_P050)
Catalog Number: ARP45501_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
Observed Staining: Cytoplasm of pneumocytes
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
Image 4 | Western Blot
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation and lipidation. |
|