DEGS1 Antibody - N-terminal region (ARP45501_P050)

Data Sheet
 
Product Number ARP45501_P050
Product Page www.avivasysbio.com/degs1-antibody-n-terminal-region-arp45501-p050.html
Name DEGS1 Antibody - N-terminal region (ARP45501_P050)
Protein Size (# AA) 323 amino acids
Molecular Weight 38 kDa
NCBI Gene Id 8560
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Delta(4)-desaturase, sphingolipid 1
Alias Symbols MLD, DEGS, DES1, Des-1, FADS7, HLD18, MIG15, DEGS-1
Peptide Sequence Synthetic peptide located within the following region: GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kraveka,J.M., (2007) J. Biol. Chem. 282 (23), 16718-16728
Description of Target DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this protein inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor.This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified.
Protein Interactions UBC; NAGPA; UBD; EGFR; TSSC1; SURF4; SLC16A1; PYGM;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-DEGS1 (ARP45501_P050) antibody
Blocking Peptide For anti-DEGS1 (ARP45501_P050) antibody is Catalog # AAP45501 (Previous Catalog # AAPP26566)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DEGS1
Uniprot ID O15121
Protein Name Sphingolipid delta(4)-desaturase DES1
Protein Accession # NP_003667
Purification Affinity Purified
Nucleotide Accession # NM_003676
Tested Species Reactivity Human
Gene Symbol DEGS1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%; Zebrafish: 93%
Image 1
293T, MCF7
Host: Rabbit
Target: DEGS1
Positive control (+): 293T (2T)
Negative control (-): MCF7 (N10)
Antibody concentration: 1ug/ml
Image 2
Human Muscle
WB Suggested Anti-DEGS1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
Image 3
Human Lung Tissue
DEGS1 antibody - N-terminal region (ARP45501_P050)
Catalog Number: ARP45501_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
Observed Staining: Cytoplasm of pneumocytes
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 4
Western Blot
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation and lipidation.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com