| Product Number |
ARP45494_P050 |
| Product Page |
www.avivasysbio.com/dgke-antibody-n-terminal-region-arp45494-p050.html |
| Name |
DGKE Antibody - N-terminal region (ARP45494_P050) |
| Protein Size (# AA) |
567 amino acids |
| Molecular Weight |
64kDa |
| NCBI Gene Id |
8526 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Diacylglycerol kinase, epsilon 64kDa |
| Alias Symbols |
DGK, AHUS7, DAGK5, DAGK6, NPHS7 |
| Peptide Sequence |
Synthetic peptide located within the following region: EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Epand,R.M., (2007) Biochemistry 46 (49), 14225-14231 |
| Description of Target |
Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis.Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis. |
| Protein Interactions |
UBC; MRPL44; ARRB2; ARRB1; NUF2; NUDC; PAICS; SET; PDHA1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DGKE (ARP45494_P050) antibody |
| Blocking Peptide |
For anti-DGKE (ARP45494_P050) antibody is Catalog # AAP45494 (Previous Catalog # AAPP26559) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DGKE |
| Uniprot ID |
P52429 |
| Protein Name |
Diacylglycerol kinase epsilon |
| Protein Accession # |
NP_003638 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003647 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
DGKE |
| Predicted Species Reactivity |
Human, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rabbit: 77% |
| Image 1 | Mouse
 | DGKE antibody - N-terminal region (ARP45494_P050) validated by WB using lymph at 1:1000. |
| | Image 2 | Human brain
 | WB Suggested Anti-DGKE Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain |
|
|
