| Product Number |
ARP45473_P050 |
| Product Page |
www.avivasysbio.com/scg2-antibody-n-terminal-region-arp45473-p050.html |
| Name |
SCG2 Antibody - N-terminal region (ARP45473_P050) |
| Protein Size (# AA) |
617 amino acids |
| Molecular Weight |
71kDa |
| NCBI Gene Id |
7857 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Secretogranin II |
| Alias Symbols |
SN, CHGC, EM66, SgII |
| Peptide Sequence |
Synthetic peptide located within the following region: KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown. |
| Protein Interactions |
ATRIP; TUBB4B; UBQLN4; COPS6; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SCG2 (ARP45473_P050) antibody |
| Blocking Peptide |
For anti-SCG2 (ARP45473_P050) antibody is Catalog # AAP45473 (Previous Catalog # AAPP26538) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SCG2 |
| Uniprot ID |
P13521 |
| Protein Name |
Secretogranin-2 |
| Protein Accession # |
NP_003460 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003469 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SCG2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SCG2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
|
