| Product Number |
ARP45386_P050 |
| Product Page |
www.avivasysbio.com/ptprr-antibody-n-terminal-region-arp45386-p050.html |
| Name |
PTPRR Antibody - N-terminal region (ARP45386_P050) |
| Protein Size (# AA) |
412 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
5801 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Protein tyrosine phosphatase, receptor type, R |
| Alias Symbols |
PTPRQ, EC-PTP, PCPTP1, PTP-SL, PTPBR7 |
| Peptide Sequence |
Synthetic peptide located within the following region: NIEPFVSIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
PTPRR is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domains, and thus represents a receptor-type PTP. |
| Protein Interactions |
MAPK3; MAPK1; MAPK7; PRKACA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PTPRR (ARP45386_P050) antibody |
| Blocking Peptide |
For anti-PTPRR (ARP45386_P050) antibody is Catalog # AAP45386 (Previous Catalog # AAPP26357) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PTPRR |
| Uniprot ID |
Q2TAJ3 |
| Protein Name |
PTPRR protein EMBL AAI10901.1 |
| Protein Accession # |
NP_570897 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_130846 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PTPRR |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human COLO205
 | WB Suggested Anti-PTPRR Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: COLO205 cell lysate |
|
