JAG2 Antibody - N-terminal region (ARP45254_P050)

Data Sheet
 
Product Number ARP45254_P050
Product Page www.avivasysbio.com/jag2-antibody-n-terminal-region-arp45254-p050.html
Name JAG2 Antibody - N-terminal region (ARP45254_P050)
Protein Size (# AA) 1238 amino acids
Molecular Weight 130kDa
NCBI Gene Id 3714
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Jagged 2
Alias Symbols HJ2, SER2
Peptide Sequence Synthetic peptide located within the following region: RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Passos Schizophr. Res. 88 (1-3), 275-282 (2006)
Description of Target The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch protein family are transmembrane receptors that are critical for various cell fate decisions. JAG2 is one of several ligands that activate Notch and related receptors. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene.
Protein Interactions GFI1B; ATN1; ATXN7; CACNA1A; MIB2; NOTCH3; NOTCH2; NOTCH1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-JAG2 (ARP45254_P050) antibody
Blocking Peptide For anti-JAG2 (ARP45254_P050) antibody is Catalog # AAP45254 (Previous Catalog # AAPY01222)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human JAG2
Uniprot ID Q9Y219
Protein Name Protein jagged-2
Protein Accession # NP_002217
Purification Affinity Purified
Nucleotide Accession # NM_002226
Tested Species Reactivity Human
Gene Symbol JAG2
Predicted Species Reactivity Human, Mouse, Rat, Pig
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-JAG2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Image 2
Human Bronchial Epithelial Tissue
JAG2 antibody - N-terminal region (ARP45254_P050)
Catalog Number: ARP45254_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Membrane of bronchial epithelial tissue
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com