Product Number |
ARP45254_P050 |
Product Page |
www.avivasysbio.com/jag2-antibody-n-terminal-region-arp45254-p050.html |
Name |
JAG2 Antibody - N-terminal region (ARP45254_P050) |
Protein Size (# AA) |
1238 amino acids |
Molecular Weight |
130kDa |
NCBI Gene Id |
3714 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Jagged 2 |
Alias Symbols |
HJ2, SER2 |
Peptide Sequence |
Synthetic peptide located within the following region: RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Passos Schizophr. Res. 88 (1-3), 275-282 (2006) |
Description of Target |
The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch protein family are transmembrane receptors that are critical for various cell fate decisions. JAG2 is one of several ligands that activate Notch and related receptors. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene. |
Protein Interactions |
GFI1B; ATN1; ATXN7; CACNA1A; MIB2; NOTCH3; NOTCH2; NOTCH1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-JAG2 (ARP45254_P050) antibody |
Blocking Peptide |
For anti-JAG2 (ARP45254_P050) antibody is Catalog # AAP45254 (Previous Catalog # AAPY01222) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human JAG2 |
Uniprot ID |
Q9Y219 |
Protein Name |
Protein jagged-2 |
Protein Accession # |
NP_002217 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_002226 |
Tested Species Reactivity |
Human |
Gene Symbol |
JAG2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Pig |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-JAG2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
| Image 2 | Human Bronchial Epithelial Tissue
| JAG2 antibody - N-terminal region (ARP45254_P050)
Catalog Number: ARP45254_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Membrane of bronchial epithelial tissue
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
|