IHH Antibody - N-terminal region (ARP45230_T100)

• Product Number: ARP45230_T100
• Name: IHH Antibody - N-terminal region (ARP45230_T100)
• Protein Size (# AA): 411 amino acids
• Molecular Weight: 45 kDa
• NCBI Gene Id: 3549
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Indian hedgehog
• Alias Symbols: BDA1, HHG2
• Peptide Sequence: Synthetic peptide located within the following region: AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kobune,M., (2004) Blood 104 (4), 1002-1009
• Description of Target: IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP).
• Protein Interactions: RHOD; HHIP; PTCH2; PTCH1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-IHH (ARP45230_T100) antibody is Catalog # AAP45230 (Previous Catalog # AAPP26226)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IHH
• Uniprot ID: Q14623
• Protein Name: Indian hedgehog protein
• Publications:

  Mirza, R. et al. 3beta-Hydroxysterol-Delta24 reductase plays an important role in long bone growth by protecting chondrocytes from reactive oxygen species. J. Bone Miner. Metab. 30, 144-53 (2012). 21845517

• Protein Accession #: NP_002172
• Purification: Protein A purified
• Nucleotide Accession #: NM_002181
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: IHH
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human kidney
  
  Human kidney
• Image 2: Mouse Heart
  
  Host: Mouse
  Target Name: IHH
  Sample Tissue: Mouse Heart
  Antibody Dilution: 1ug/ml
• Image 3: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.