FCER1A Antibody - middle region (ARP45205_P050)

• Product Number: ARP45205_P050
• Name: FCER1A Antibody - middle region (ARP45205_P050)
• Protein Size (# AA): 257 amino acids
• Molecular Weight: 27kDa
• Subunit: alpha
• NCBI Gene Id: 2205
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
• Alias Symbols: FCE1A, FcERI
• Peptide Sequence: Synthetic peptide located within the following region: IYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNIT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Potaczek,D.P., (2008) Allergy 63 (5), 626-627
• Description of Target: The IgE receptor plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more high-affinity IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule. A perturbation occurs that brings about the release of histamine and proteases from the granules in the cytoplasm of the mast cell and leads to the synthesis of prostaglandins and leukotrienes--potent effectors of the hypersensitivity response. The IgE receptor consists of 3 subunits: alpha, beta (MIM 147138), and gamma (MIM 147139); only the alpha subunit is glycosylated.The IgE receptor plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more high-affinity IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule. A perturbation occurs that brings about the release of histamine and proteases from the granules in the cytoplasm of the mast cell and leads to the synthesis of prostaglandins and leukotrienes--potent effectors of the hypersensitivity response. The IgE receptor consists of 3 subunits: alpha, beta (MIM 147138), and gamma (MIM 147139); only the alpha subunit is glycosylated.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: PDHB; SYK; FCER1A; FCER1G; MS4A2; ITIH2; VAV1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: Catalog # AAP45205 (Previous Catalog # AAPP26194)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FCER1A
• Uniprot ID: P12319
• Protein Name: High affinity immunoglobulin epsilon receptor subunit alpha
• Protein Accession #: NP_001992
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002001
• Tested Species Reactivity: Human
• Gene Symbol: FCER1A
• Predicted Species Reactivity: Human, Rat, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rabbit: 85%; Rat: 77%
• Image 1: Human Muscle
  
  WB Suggested Anti-FCER1A Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Muscle