| Product Number |
ARP45200_P050 |
| Product Page |
www.avivasysbio.com/dsg2-antibody-middle-region-arp45200-p050.html |
| Name |
Dsg2 Antibody - middle region (ARP45200_P050) |
| Protein Size (# AA) |
1122 amino acids |
| Molecular Weight |
122kDa |
| NCBI Gene Id |
13511 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
AA408168, D18Ertd293, D18Ertd293e |
| Peptide Sequence |
Synthetic peptide located within the following region: TDADEVGSDNWLANFTFASGNEGGYFHIETDTQTNEGIVTLVKEVDYEEM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Dsg2 (ARP45200_P050) antibody |
| Blocking Peptide |
For anti-Dsg2 (ARP45200_P050) antibody is Catalog # AAP45200 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Dsg2 |
| Uniprot ID |
O55111 |
| Protein Name |
Desmoglein-2 |
| Protein Accession # |
NP_031909 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007883 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Dsg2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 93%; Rabbit: 85%; Rat: 100% |
| Image 1 | Mouse Testis
 | Host: Rabbit
Target Name: Dsg2
Sample Type: Mouse Testis lysates
Antibody Dilution: 1.0ug/ml |
|
|
