| Product Number |
ARP45198_P050-HRP |
| Product Page |
www.avivasysbio.com/dsg2-antibody-n-terminal-region-hrp-arp45198-p050-hrp.html |
| Name |
DSG2 Antibody - N-terminal region : HRP (ARP45198_P050-HRP) |
| Protein Size (# AA) |
1118 amino acids |
| Molecular Weight |
114kDa |
| Conjugation |
HRP: Horseradish Peroxidase |
| NCBI Gene Id |
1829 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Desmoglein 2 |
| Alias Symbols |
HDGC, CDHF5 |
| Peptide Sequence |
Synthetic peptide located within the following region: KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE |
| Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Reference |
Cirillo,N., (2008) J. Cell. Biochem. 103 (2), 598-606 |
| Description of Target |
Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. This gene product is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines. Mutations in this gene have been associated with arrhythmogenic right ventricular dysplasia, familial, 10. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
UBC; SART3; EED; ADRB2; PAN2; CHCHD2; PLIN3; Trim69; Cbx1; RYK; PKP3; PKP2; JUP; DSC2; DSC1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-DSG2 (ARP45198_P050-HRP) antibody |
| Additional Information |
IHC Information: Pancreas, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Pancreas, Human: Formalin-Fixed, Paraffin-Embedded (FFPE) |
| Blocking Peptide |
For anti-DSG2 (ARP45198_P050-HRP) antibody is Catalog # AAP45198 (Previous Catalog # AAPP26187) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DSG2 |
| Uniprot ID |
Q14126 |
| Protein Name |
Desmoglein-2 |
| Publications |
Hummitzsch, K. et al. A new model of development of the mammalian ovary and follicles. PLoS One 8, e55578 (2013). WB, ICC/IF, IHC, Rat, Pig, Human, Mouse, Bovine, Dog, Horse, Rabbit, Guinea pig 23409002 |
| Protein Accession # |
NP_001934 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001943 |
| Gene Symbol |
DSG2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | |
|
|
