| Product Number |
ARP45156_P050 |
| Product Page |
www.avivasysbio.com/atp1b2-antibody-n-terminal-region-arp45156-p050.html |
| Name |
Atp1b2 Antibody - N-terminal region (ARP45156_P050) |
| Protein Size (# AA) |
290 amino acids |
| Molecular Weight |
33 kDa |
| Subunit |
beta-2 |
| NCBI Gene Id |
11932 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ATPase, Na+/K+ transporting, beta 2 polypeptide |
| Alias Symbols |
Am, Amog, Atpb, Atpb-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane. The exact function of the beta-2 subunit is not known. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-Atp1b2 (ARP45156_P050) antibody |
| Blocking Peptide |
For anti-Atp1b2 (ARP45156_P050) antibody is Catalog # AAP45156 (Previous Catalog # AAPP26145) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
P14231 |
| Protein Name |
Sodium/potassium-transporting ATPase subunit beta-2 |
| Publications |
Li, Y.-G. et al. 1-deoxynojirimycin inhibits glucose absorption and accelerates glucose metabolism in streptozotocin-induced diabetic mice. Sci. Rep. 3, 1377 (2013). 23536174
Li, Y.-G., Ji, D.-F., Zhong, S., Lv, Z.-Q. & Lin, T.-B. Cooperative anti-diabetic effects of deoxynojirimycin-polysaccharide by inhibiting glucose absorption and modulating glucose metabolism in streptozotocin-induced diabetic mice. PLoS One 8, e65892 (2013). 23755289 |
| Protein Accession # |
NP_038201 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_013415 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Atp1b2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB, IHC, IHC-F |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Mouse Kidney
 | WB Suggested Anti-Atp1b2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse Kidney |
|
| Image 2 |
 | 25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. The protein may be modified by glycosylation.
|
|
