| Product Number |
ARP45116_P050 |
| Product Page |
www.avivasysbio.com/b4galnt1-antibody-n-terminal-region-arp45116-p050.html |
| Name |
B4GALNT1 Antibody - N-terminal region (ARP45116_P050) |
| Protein Size (# AA) |
533 amino acids |
| Molecular Weight |
59kDa |
| NCBI Gene Id |
2583 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Beta-1,4-N-acetyl-galactosaminyl transferase 1 |
| Alias Symbols |
GALGT, SPG26, GALNACT, GalNAc-T |
| Peptide Sequence |
Synthetic peptide located within the following region: APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gornati,R., Mol. Cell. Biochem. 298 (1-2), 59-68 (2007) |
| Description of Target |
GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively. |
| Protein Interactions |
UBC; B4GALNT1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-B4GALNT1 (ARP45116_P050) antibody |
| Blocking Peptide |
For anti-B4GALNT1 (ARP45116_P050) antibody is Catalog # AAP45116 (Previous Catalog # AAPP26107) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human B4GALNT1 |
| Uniprot ID |
Q00973 |
| Protein Name |
Beta-1,4 N-acetylgalactosaminyltransferase 1 |
| Protein Accession # |
NP_001469 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001478 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
B4GALNT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-B4GALNT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
