| Product Number |
ARP45086_P050 |
| Product Page |
www.avivasysbio.com/dscam-antibody-middle-region-arp45086-p050.html |
| Name |
DSCAM Antibody - middle region (ARP45086_P050) |
| Protein Size (# AA) |
2012 amino acids |
| Molecular Weight |
220kDa |
| NCBI Gene Id |
1826 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Down syndrome cell adhesion molecule |
| Description |
|
| Alias Symbols |
CHD2, CHD2-42, CHD2-52 |
| Peptide Sequence |
Synthetic peptide located within the following region: MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693 |
| Description of Target |
DSCAM is a cell adhesion molecule that can mediate cation-independent homophilic binding activity. DSCAM could be involved in nervous system development. |
| Protein Interactions |
LGR4; UBC; PAK1; ESR1; POLR2A; FOXA1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DSCAM (ARP45086_P050) antibody |
| Blocking Peptide |
For anti-DSCAM (ARP45086_P050) antibody is Catalog # AAP45086 (Previous Catalog # AAPP12374) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DSCAM |
| Uniprot ID |
O60469 |
| Protein Name |
Down syndrome cell adhesion molecule |
| Protein Accession # |
NP_001380 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001389 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
DSCAM |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB, IP |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-DSCAM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate |
|
| Image 2 | Mouse
 | Amount and Sample Type:
10 cm sq plate myc-DSCAM transfected mouse neuro2a cells
Primary Antibody:
DSCAM
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-Rabbit HRP
Secondary Antibody Dilution:
1:5000
Gene Name:
DSCAM
Submitted by:
Amir Gamliel, UCSD
|
|
