CDS1 Antibody - middle region (ARP45073_P050)

• Product Number: ARP45073_P050
• Name: CDS1 Antibody - middle region (ARP45073_P050)
• Protein Size (# AA): 461 amino acids
• Molecular Weight: 53 kDa
• NCBI Gene Id: 1040
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1
• Alias Symbols: CDS 1
• Peptide Sequence: Synthetic peptide located within the following region: VVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Volta,M., (1999) Genomics 55 (1), 68-77
• Description of Target: Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. CDS1 is an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis.Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. This gene encodes an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis. Two genes encoding this enzyme have been identified in humans, one mapping to human chromosome 4q21 and a second to 20p13.
• Protein Interactions: UBC; CDC25C;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-CDS1 (ARP45073_P050) antibody is Catalog # AAP45073 (Previous Catalog # AAPP12361)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDS1
• Uniprot ID: Q92903
• Protein Name: Phosphatidate cytidylyltransferase 1
• Publications:

  Croston, T. L. et al. Evaluation of the cardiolipin biosynthetic pathway and its interactions in the diabetic heart. Life Sci. 93, 313-22 (2013). 23872101

• Sample Type Confirmation:

  CDS1 is supported by BioGPS gene expression data to be expressed in HEK293T

• Protein Accession #: NP_001254
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001263
• Tested Species Reactivity: Human
• Gene Symbol: CDS1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human lung, HeLa
  
  Host: Rabbit
  Target: CDS1
  Positive control (+): Human lung (LU)
  Negative control (-): HeLa (HL)
  Antibody concentration: 1ug/ml
• Image 2: Human 293T
  
  WB Suggested Anti-CDS1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 293T cell lysateCDS1 is supported by BioGPS gene expression data to be expressed in HEK293T