AADAC Antibody - N-terminal region (ARP45036_P050)

Data Sheet
 
Product Number ARP45036_P050
Product Page www.avivasysbio.com/aadac-antibody-n-terminal-region-arp45036-p050.html
Name AADAC Antibody - N-terminal region (ARP45036_P050)
Protein Size (# AA) 399 amino acids
Molecular Weight 46kDa
NCBI Gene Id 13
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Arylacetamide deacetylase (esterase)
Alias Symbols DAC, CES5A1
Peptide Sequence Synthetic peptide located within the following region: AHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Frick,C., (2004) J. Biol. Chem. 279 (30), 31131-31138
Description of Target Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-5 AV705031.1 1-5 6-247 L32179.1 1-242 248-1725 BC032309.1 183-1660
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-AADAC (ARP45036_P050) antibody
Blocking Peptide For anti-AADAC (ARP45036_P050) antibody is Catalog # AAP45036 (Previous Catalog # AAPP12324)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human AADAC
Uniprot ID P22760
Protein Name Arylacetamide deacetylase
Protein Accession # NP_001077
Purification Affinity Purified
Nucleotide Accession # NM_001086
Tested Species Reactivity Human
Gene Symbol AADAC
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 91%; Rabbit: 100%; Rat: 90%
Image 1
Transfected 293T
WB Suggested Anti-AADAC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
Image 2
Human Fetal Liver
Host: Rabbit
Target Name: AADAC
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com