Product Number |
ARP45036_P050 |
Product Page |
www.avivasysbio.com/aadac-antibody-n-terminal-region-arp45036-p050.html |
Name |
AADAC Antibody - N-terminal region (ARP45036_P050) |
Protein Size (# AA) |
399 amino acids |
Molecular Weight |
46kDa |
NCBI Gene Id |
13 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Arylacetamide deacetylase (esterase) |
Alias Symbols |
DAC, CES5A1 |
Peptide Sequence |
Synthetic peptide located within the following region: AHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Frick,C., (2004) J. Biol. Chem. 279 (30), 31131-31138 |
Description of Target |
Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-5 AV705031.1 1-5 6-247 L32179.1 1-242 248-1725 BC032309.1 183-1660 |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-AADAC (ARP45036_P050) antibody |
Blocking Peptide |
For anti-AADAC (ARP45036_P050) antibody is Catalog # AAP45036 (Previous Catalog # AAPP12324) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human AADAC |
Uniprot ID |
P22760 |
Protein Name |
Arylacetamide deacetylase |
Protein Accession # |
NP_001077 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001086 |
Tested Species Reactivity |
Human |
Gene Symbol |
AADAC |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 91%; Rabbit: 100%; Rat: 90% |
Image 1 | Transfected 293T
| WB Suggested Anti-AADAC Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T |
|
Image 2 | Human Fetal Liver
| Host: Rabbit Target Name: AADAC Sample Type: Human Fetal Liver Antibody Dilution: 1.0ug/ml |
|