KIAA0317 Antibody - N-terminal region (ARP44874_P050)

Data Sheet
 
Product Number ARP44874_P050
Product Page www.avivasysbio.com/kiaa0317-antibody-n-terminal-region-arp44874-p050.html
Name KIAA0317 Antibody - N-terminal region (ARP44874_P050)
Protein Size (# AA) 823 amino acids
Molecular Weight 94kDa
NCBI Gene Id 9870
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name KIAA0317
Alias Symbols FIEL1, KIAA0317
Peptide Sequence Synthetic peptide located within the following region: LTCGQPHTLQIVPRDEYDNPTNNSMSLRDEHNYTLSIHELGPQEEESTGV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.
Protein Interactions UBC; Htra2; DIABLO; AREL1; UBE2D1; SEPT4; HSP90AA1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-AREL1 (ARP44874_P050) antibody
Blocking Peptide For anti-AREL1 (ARP44874_P050) antibody is Catalog # AAP44874 (Previous Catalog # AAPP25953)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0317
Uniprot ID O15033
Protein Name Protein KIAA0317
Publications

Ubiquitin E3 ligase FIEL1 regulates fibrotic lung injury through SUMO-E3 ligase PIAS4. J Exp Med. 2016 May 30 213(6): 1029-1046. 27162139

Sample Type Confirmation

AREL1 is supported by BioGPS gene expression data to be expressed in HT1080

Protein Accession # NP_001034568
Purification Affinity Purified
Nucleotide Accession # NM_001039479
Tested Species Reactivity Human
Gene Symbol AREL1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Human Lung, Respiratory Epithelium
Rabbit Anti-KIAA0317 antibody
Catalog Number: ARP44874
Formalin Fixed Paraffin Embedded Tissue: Human Lung, Respiratory Epithelium
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
Image 2
Human Tonsil
Rabbit Anti-KIAA0317 antibody
Catalog Number: ARP44874
Formalin Fixed Paraffin Embedded Tissue: Human Tonsil
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
Image 3
Human HT1080
WB Suggested Anti-KIAA0317 Antibody Titration: 0.2-1 ug/ml
Positive Control: HT1080 cell lysateAREL1 is supported by BioGPS gene expression data to be expressed in HT1080
Image 4
Human Pineal Tissue
Rabbit Anti-AREL1 Antibody
Catalog Number: ARP44874_P050
Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
Observed Staining: Cytoplasmic in vesicles in cell bodies of pinealocytes
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com