Product Number |
ARP44874_P050 |
Product Page |
www.avivasysbio.com/kiaa0317-antibody-n-terminal-region-arp44874-p050.html |
Name |
KIAA0317 Antibody - N-terminal region (ARP44874_P050) |
Protein Size (# AA) |
823 amino acids |
Molecular Weight |
94kDa |
NCBI Gene Id |
9870 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
KIAA0317 |
Alias Symbols |
FIEL1, KIAA0317 |
Peptide Sequence |
Synthetic peptide located within the following region: LTCGQPHTLQIVPRDEYDNPTNNSMSLRDEHNYTLSIHELGPQEEESTGV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown. |
Protein Interactions |
UBC; Htra2; DIABLO; AREL1; UBE2D1; SEPT4; HSP90AA1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-AREL1 (ARP44874_P050) antibody |
Blocking Peptide |
For anti-AREL1 (ARP44874_P050) antibody is Catalog # AAP44874 (Previous Catalog # AAPP25953) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0317 |
Uniprot ID |
O15033 |
Protein Name |
Protein KIAA0317 |
Publications |
Ubiquitin E3 ligase FIEL1 regulates fibrotic lung injury through SUMO-E3 ligase PIAS4. J Exp Med. 2016 May 30
213(6): 1029-1046. 27162139 |
Sample Type Confirmation |
AREL1 is supported by BioGPS gene expression data to be expressed in HT1080 |
Protein Accession # |
NP_001034568 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001039479 |
Tested Species Reactivity |
Human |
Gene Symbol |
AREL1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
Image 1 | Human Lung, Respiratory Epithelium
| Rabbit Anti-KIAA0317 antibody Catalog Number: ARP44874 Formalin Fixed Paraffin Embedded Tissue: Human Lung, Respiratory Epithelium Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec
|
|
Image 2 | Human Tonsil
| Rabbit Anti-KIAA0317 antibody Catalog Number: ARP44874 Formalin Fixed Paraffin Embedded Tissue: Human Tonsil Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec
|
|
Image 3 | Human HT1080
| WB Suggested Anti-KIAA0317 Antibody Titration: 0.2-1 ug/ml Positive Control: HT1080 cell lysateAREL1 is supported by BioGPS gene expression data to be expressed in HT1080 |
|
Image 4 | Human Pineal Tissue
| Rabbit Anti-AREL1 Antibody Catalog Number: ARP44874_P050 Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in vesicles in cell bodies of pinealocytes Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
|
|