NRCAM Antibody - N-terminal region (ARP44833_T100)

• Product Number: ARP44833_T100
• Name: NRCAM Antibody - N-terminal region (ARP44833_T100)
• Protein Size (# AA): 1304 amino acids
• Molecular Weight: 141kDa
• NCBI Gene Id: 4897
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Neuronal cell adhesion molecule
• Alias Symbols: KIAA0343, MGC138845, MGC138846
• Peptide Sequence: Synthetic peptide located within the following region: NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ishiguro,H., (er) Neuropsychopharmacology (2005) In press
• Description of Target: Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. This gene encodes a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. This gene is also expressed in non-neural tissues and may play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of this gene have been associated with autism and addiction vulnerability. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Protein Interactions: LNX1; MAGI3; HSPA12A; MACF1; UBC; NFASC; NRCAM; CNTN2; PTPRB; ANK2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NRCAM (ARP44833_T100) antibody is Catalog # AAP44833 (Previous Catalog # AAPP25913)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NRCAM
• Uniprot ID: Q92823
• Protein Name: Neuronal cell adhesion molecule
• Protein Accession #: NP_001032209
• Purification: Protein A purified
• Nucleotide Accession #: NM_001037132
• Tested Species Reactivity: Human
• Gene Symbol: NRCAM
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-NRCAM Antibody Titration: 2.5ug/ml
  Positive Control: HepG2 cell lysate
• Image 2: Human kidney
  
  Human kidney