| Product Number |
ARP44820_P050 |
| Product Page |
www.avivasysbio.com/erp29-antibody-n-terminal-region-arp44820-p050.html |
| Name |
ERP29 Antibody - N-terminal region (ARP44820_P050) |
| Protein Size (# AA) |
261 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
10961 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Endoplasmic reticulum protein 29 |
| Description |
|
| Alias Symbols |
ERp28, ERp31, PDIA9, PDI-DB, C12orf8, HEL-S-107 |
| Peptide Sequence |
Synthetic peptide located within the following region: MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Protein Interactions |
HUWE1; CIAO1; UBC; MDM2; GLP1R; ATF2; UBQLN4; H2AFX; ERP29; HSPA5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ERP29 (ARP44820_P050) antibody |
| Blocking Peptide |
For anti-ERP29 (ARP44820_P050) antibody is Catalog # AAP44820 (Previous Catalog # AAPP12296) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ERP29 |
| Uniprot ID |
P30040 |
| Protein Name |
Endoplasmic reticulum resident protein 29 |
| Publications |
Protein disulfide isomerase secretion following vascular injury initiates a regulatory pathway for thrombus formation. Nat Commun. 8, 14151 (2017). 28218242 |
| Sample Type Confirmation |
ERP29 is supported by BioGPS gene expression data to be expressed in ACHN |
| Protein Accession # |
NP_006808 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006817 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ERP29 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93% |
| Image 1 | Human ACHN
 | WB Suggested Anti-ERP29 Antibody Titration: 0.2-1 ug/ml
Positive Control: ACHN cell lysateERP29 is supported by BioGPS gene expression data to be expressed in ACHN |
|
| Image 2 | Human heart
 | Rabbit Anti-ERP29 Antibody
Catalog Number: ARP44820_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
