ENTPD8 Antibody - N-terminal region (ARP44815_P050)

Data Sheet
 
Product Number ARP44815_P050
Product Page www.avivasysbio.com/entpd8-antibody-n-terminal-region-arp44815-p050.html
Name ENTPD8 Antibody - N-terminal region (ARP44815_P050)
Protein Size (# AA) 495 amino acids
Molecular Weight 54kDa
NCBI Gene Id 377841
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ectonucleoside triphosphate diphosphohydrolase 8
Description
Alias Symbols UNQ2492, GLSR2492, E-NTPDase, NTPDase-8
Peptide Sequence Synthetic peptide located within the following region: IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Munkonda,M.N., (2007) Biochem. Pharmacol. 74 (10), 1524-1534
Description of Target ENTPD8 is the canalicular ectonucleoside NTPDase responsible for the main hepatic NTPDase activity. Ectonucleoside NTPDases catalyze the hydrolyzis of gamma- and beta-phosphate residues of nucleotides, playing a central role in concentration of extracellular nucleotides. It has activity toward ATP, ADP, UTP and UDP, but not toward AMP.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ENTPD8 (ARP44815_P050) antibody
Blocking Peptide For anti-ENTPD8 (ARP44815_P050) antibody is Catalog # AAP44815 (Previous Catalog # AAPP12291)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ENTPD8
Uniprot ID Q5MY95
Protein Name Ectonucleoside triphosphate diphosphohydrolase 8
Publications

Generation and Characterization of Specific Antibodies to the Murine and Human Ectonucleotidase NTPDase8. Front Pharmacol. 8, 115 (2017). 28337144

Protein Accession # NP_001028285
Purification Affinity Purified
Nucleotide Accession # NM_001033113
Tested Species Reactivity Human
Gene Symbol ENTPD8
Predicted Species Reactivity Human, Mouse, Rat, Cow, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 79%
Image 1
Human Lung
WB Suggested Anti-ENTPD8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com