Product Number |
ARP44815_P050 |
Product Page |
www.avivasysbio.com/entpd8-antibody-n-terminal-region-arp44815-p050.html |
Name |
ENTPD8 Antibody - N-terminal region (ARP44815_P050) |
Protein Size (# AA) |
495 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
377841 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ectonucleoside triphosphate diphosphohydrolase 8 |
Description |
|
Alias Symbols |
UNQ2492, GLSR2492, E-NTPDase, NTPDase-8 |
Peptide Sequence |
Synthetic peptide located within the following region: IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Munkonda,M.N., (2007) Biochem. Pharmacol. 74 (10), 1524-1534 |
Description of Target |
ENTPD8 is the canalicular ectonucleoside NTPDase responsible for the main hepatic NTPDase activity. Ectonucleoside NTPDases catalyze the hydrolyzis of gamma- and beta-phosphate residues of nucleotides, playing a central role in concentration of extracellular nucleotides. It has activity toward ATP, ADP, UTP and UDP, but not toward AMP. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ENTPD8 (ARP44815_P050) antibody |
Blocking Peptide |
For anti-ENTPD8 (ARP44815_P050) antibody is Catalog # AAP44815 (Previous Catalog # AAPP12291) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ENTPD8 |
Uniprot ID |
Q5MY95 |
Protein Name |
Ectonucleoside triphosphate diphosphohydrolase 8 |
Publications |
Generation and Characterization of Specific Antibodies to the Murine and Human Ectonucleotidase NTPDase8. Front Pharmacol. 8, 115 (2017). 28337144 |
Protein Accession # |
NP_001028285 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001033113 |
Tested Species Reactivity |
Human |
Gene Symbol |
ENTPD8 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 79% |
Image 1 | Human Lung
| WB Suggested Anti-ENTPD8 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Lung |
|