C1orf151 Antibody - middle region (ARP44801_P050)

• Product Number: ARP44801_P050
• Name: C1orf151 Antibody - middle region (ARP44801_P050)
• Protein Size (# AA): 78 amino acids
• Molecular Weight: 9 kDa
• NCBI Gene Id: 440574
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Mitochondrial inner membrane organizing system 1
• Description:
  View product citations for C1orf151 Antibody - middle region (ARP44801_P050) on CiteAb
• Alias Symbols: MIO10, Mic10, MINOS1, C1orf151
• Peptide Sequence: Synthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321
• Description of Target: The exact function of C1orf151 remains unknown.
• Protein Interactions: MIA3; GSTK1; IBA57; RDH13; COA7; DNAJC11; CHCHD3; RMDN1; SAMM50; ACOT9; IMMT; TUBGCP2; MTHFD2; MTX2; TUBG1; MAPK1; MTX1; HSPA9; GDI1; FECH; ACSL4; C1QBP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-MINOS1 (ARP44801_P050) antibody is Catalog # AAP44801 (Previous Catalog # AAPP12277)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf151
• Uniprot ID: Q5TGZ0
• Protein Name: Mitochondrial inner membrane organizing system protein 1
• Publications:

  A novel homozygous variant in MICOS13/QIL1 causes hepato-encephalopathy with mitochondrial DNA depletion syndrome. Mol Genet Genomic Med. 8, e1427 (2020). 32749073

  Accessory subunits are integral for assembly and function of human mitochondrial complex I. Nature. 538, 123-126 (2016). 27626371

  Dissecting the Roles of Mitochondrial Complex I Intermediate Assembly Complex Factors in the Biogenesis of Complex I. Cell Rep. 31, 107541 (2020). 32320651

  FAM92A1 is a BAR domain protein required for mitochondrial ultrastructure and function. J Cell Biol. 218, 97-111 (2019). 30404948

  Jans, D. C. et al. STED super-resolution microscopy reveals an array of MINOS clusters along human mitochondria. Proc. Natl. Acad. Sci. U. S. A. 110, 8936-41 (2013). 23676277

  Mitochondrial hepato-encephalopathy due to deficiency of QIL1/MIC13 (C19orf70), a MICOS complex subunit. Eur J Hum Genet. 24, 1778-1782 (2016). 27485409

• Protein Accession #: NP_001027535
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001032363
• Tested Species Reactivity: Human
• Gene Symbol: MINOS1
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Liver Tumor
  
  Host: Rabbit
  Target Name: MINOS1
  Sample Tissue: Human Liver Tumor
  Antibody Dilution: 1ug/ml
• Image 2: Human COLO205 Whole Cell
  
  Host: Rabbit
  Target Name: MINOS1
  Sample Tissue: Human COLO205 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 3: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.