| Product Number |
ARP44777_P050 |
| Product Page |
www.avivasysbio.com/ccdc90a-antibody-middle-region-arp44777-p050.html |
| Name |
CCDC90A Antibody - middle region (ARP44777_P050) |
| Protein Size (# AA) |
359 amino acids |
| Molecular Weight |
40kDa |
| NCBI Gene Id |
63933 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Coiled-coil domain containing 90A |
| Description |
|
| Alias Symbols |
FMP32, C6orf79, CCDC90A |
| Peptide Sequence |
Synthetic peptide located within the following region: ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Mallilankaraman K, Cárdenas C, Doonan PJ, Chandramoorthy HC, Irrinki KM, Golenár T, Csordás G, Madireddi P, Yang J, Muller M, Miller R, Kolesar JE, Molgo J, Kaufman B, Hajnoczky G, Foskett JK and Madesh M. 2012. MCUR1 is an Essential Component of Mitochondrial Ca2+ Uptake that Regulates Cellular Metabolism. Nature Cell Biol 14:1336-43
Calcium: Helping Ca2+ into mitochondria, Nature Rev Mol Cell Biol. 2012 14(4):4 |
| Description of Target |
Essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MCUR1 (ARP44777_P050) antibody |
| Blocking Peptide |
For anti-MCUR1 (ARP44777_P050) antibody is Catalog # AAP44777 (Previous Catalog # AAPP34340) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CCDC90A |
| Uniprot ID |
Q96AQ8 |
| Protein Name |
Coiled-coil domain-containing protein 90A, mitochondrial |
| Publications |
Ca2+ signals regulate mitochondrial metabolism by stimulating CREB-mediated expression of the mitochondrial Ca2+ uniporter gene MCU. Sci Signal. 8, ra23 (2015). 25737585
Mallilankaraman, K. et al. MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. Nat. Cell Biol. 14, 1336-43 (2012). 23178883 |
| Protein Accession # |
NP_001026883 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001031713 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MCUR1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rat: 93% |
| Image 1 | Human Jurkat Whole Cell
 | Host: Rabbit
Target Name: MCUR1
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml |
|
| Image 2 | Human Jurkat Whole Cell
 | Host: Rabbit
Target Name: CCDC90A
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 3ug/ml |
|
| Image 3 | OVCAR-3
 | Host: Rabbit
Target Name: MCUR1
Sample Type: OVCAR-3 Cell lysates
Antibody Dilution: 1.0ug/ml |
|
