ANO6 Antibody -C-terminal region : HRP (ARP44761_P050-HRP)

Data Sheet
 
Product Number ARP44761_P050-HRP
Product Page www.avivasysbio.com/ano6-antibody-c-terminal-region-hrp-arp44761-p050-hrp.html
Name ANO6 Antibody -C-terminal region : HRP (ARP44761_P050-HRP)
Protein Size (# AA) 910 amino acids
Molecular Weight 106kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 196527
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Anoctamin 6
Alias Symbols SCTS, BDPLT7, TMEM16F
Peptide Sequence Synthetic peptide located within the following region: KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Description of Target TMEM16F may act as a calcium-activated chloride channel.
Protein Interactions UBC; ELAVL1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-ANO6 (ARP44761_P050-HRP) antibody
Blocking Peptide For anti-ANO6 (ARP44761_P050-HRP) antibody is Catalog # AAP44761 (Previous Catalog # AAPP12410)
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human ANO6
Uniprot ID Q4KMQ2
Protein Name Anoctamin-6
Protein Accession # NP_001020527
Purification Affinity Purified
Nucleotide Accession # NM_001025356
Gene Symbol ANO6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com