Product Number |
ARP44761_P050 |
Product Page |
www.avivasysbio.com/ano6-antibody-c-terminal-region-arp44761-p050.html |
Name |
ANO6 Antibody -C-terminal region (ARP44761_P050) |
Protein Size (# AA) |
910 amino acids |
Molecular Weight |
106kDa |
NCBI Gene Id |
196527 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Anoctamin 6 |
Description |
|
Alias Symbols |
SCTS, BDPLT7, TMEM16F |
Peptide Sequence |
Synthetic peptide located within the following region: KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
TMEM16F may act as a calcium-activated chloride channel. |
Protein Interactions |
UBC; ELAVL1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ANO6 (ARP44761_P050) antibody |
Blocking Peptide |
For anti-ANO6 (ARP44761_P050) antibody is Catalog # AAP44761 (Previous Catalog # AAPP12410) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human ANO6 |
Uniprot ID |
Q4KMQ2 |
Protein Name |
Anoctamin-6 |
Publications |
Anoctamin 6 mediates effects essential for innate immunity downstream of P2X7 receptors in macrophages. Nat Commun. 6, 6245 (2015). 25651887 |
Protein Accession # |
NP_001020527 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001025356 |
Tested Species Reactivity |
Human |
Gene Symbol |
ANO6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93% |
Image 1 | Human OVCAR-3
| WB Suggested Anti-ANO6 Antibody Titration: 0.2-1 ug/ml Positive Control: OVCAR-3 cell lysate |
|
|