| Product Number |
ARP44759_P050 |
| Product Page |
www.avivasysbio.com/ano6-antibody-middle-region-arp44759-p050.html |
| Name |
Ano6 Antibody - middle region (ARP44759_P050) |
| Protein Size (# AA) |
911 amino acids |
| Molecular Weight |
106kDa |
| NCBI Gene Id |
105722 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Anoctamin 6 |
| Alias Symbols |
Tmem16f, AA407480, AW554778, 2900059G15Rik, F730003B03Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Ano6 may act as a calcium-activated chloride channel By similarity. It is essential for calcium-dependent exposure of phosphatidylserine on the surface of activated platelets, a process necessary to trigger the clotting system. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Ano6 (ARP44759_P050) antibody |
| Blocking Peptide |
For anti-Ano6 (ARP44759_P050) antibody is Catalog # AAP44759 (Previous Catalog # AAPP12235) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q6P9J9 |
| Protein Name |
Anoctamin-6 |
| Protein Accession # |
NP_780553 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_175344 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Ano6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 77%; Human: 100%; Mouse: 92%; Pig: 93%; Rat: 92% |
| Image 1 | Mouse Liver
 | WB Suggested Anti-Ano6 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Liver |
|
|
