| Product Number |
ARP44679_P050 |
| Product Page |
www.avivasysbio.com/tmem93-antibody-n-terminal-region-arp44679-p050.html |
| Name |
TMEM93 Antibody - N-terminal region (ARP44679_P050) |
| Protein Size (# AA) |
110 amino acids |
| Molecular Weight |
12kDa |
| NCBI Gene Id |
83460 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transmembrane protein 93 |
| Description |
|
| Alias Symbols |
TMEM93, RAB5IFL |
| Peptide Sequence |
Synthetic peptide located within the following region: AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954 |
| Description of Target |
TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EMC6 (ARP44679_P050) antibody |
| Blocking Peptide |
For anti-EMC6 (ARP44679_P050) antibody is Catalog # AAP44679 (Previous Catalog # AAPP12151) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM93 |
| Uniprot ID |
Q9BV81 |
| Protein Name |
ER membrane protein complex subunit 6 |
| Publications |
The ER Membrane Protein Complex Promotes Biogenesis of Dengue and Zika Virus Non-structural Multi-pass Transmembrane Proteins to Support Infection. Cell Rep. 27, 1666-1674.e4 (2019). 31067454 |
| Sample Type Confirmation |
EMC6 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_112588 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_031298 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EMC6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
| Application |
WB, IP |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | HEK293 Whole Cell Lysate
 | EMC6 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with ARP44679_P050 with 1:200 dilution. Western blot was performed using ARP44679_P050 at 1/1000 dilution.
Lane 1: Control IP in HEK293 Whole Cell Lysate.
Lane 2: EMC6 IP with ARP44679_P050 in HEK293 Whole Cell Lysate.
Lane 3: Input of HEK293 Whole Cell Lysate. |
|
| Image 2 | 293T, HeLa
 | Host: Rabbit
Target: EMC6
Positive control (+): 293T (2T)
Negative control (-): HeLa (HL)
Antibody concentration: 3ug/ml |
|
| Image 3 | Human Jurkat
 | WB Suggested Anti-TMEM93 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateEMC6 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
