| Product Number |
ARP44654_P050 |
| Product Page |
www.avivasysbio.com/aadacl4-antibody-n-terminal-region-arp44654-p050.html |
| Name |
AADACL4 Antibody - N-terminal region (ARP44654_P050) |
| Protein Size (# AA) |
407 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
343066 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Arylacetamide deacetylase-like 4 |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-AADACL4 (ARP44654_P050) antibody |
| Blocking Peptide |
For anti-AADACL4 (ARP44654_P050) antibody is Catalog # AAP44654 (Previous Catalog # AAPP12126) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human AADACL4 |
| Uniprot ID |
Q5VUY2 |
| Protein Name |
Arylacetamide deacetylase-like 4 |
| Protein Accession # |
NP_001013652 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001013630 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
AADACL4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 100%; Horse: 83%; Human: 100%; Mouse: 92%; Rabbit: 86%; Rat: 100% |
| Image 1 | Human Thymus
 | WB Suggested Anti-AADACL4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Thymus |
|
|
