Product Number |
ARP44638_P050 |
Product Page |
www.avivasysbio.com/rp11-50d16-3-antibody-middle-region-arp44638-p050.html |
Name |
RP11-50D16.3 Antibody - middle region (ARP44638_P050) |
Protein Size (# AA) |
347 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
387921 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
NHL repeat containing 3 |
Alias Symbols |
DKFZp313M1221, DKFZp686E1140, LOC387921, RP11-50D16.3 |
Peptide Sequence |
Synthetic peptide located within the following region: LVQVLGTPGKKGTSLNPLQFDNPAELYVEDTGDIYIVDGDGGLNNRLIKL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
Description of Target |
RP11-50D16.3 contains 4 NHL repeats. The function of the RP11-50D16.3 protein remains unknown. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NHLRC3 (ARP44638_P050) antibody |
Blocking Peptide |
For anti-NHLRC3 (ARP44638_P050) antibody is Catalog # AAP44638 (Previous Catalog # AAPP12110) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RP11-50D16.3 |
Uniprot ID |
Q5JS37 |
Protein Name |
NHL repeat-containing protein 3 |
Protein Accession # |
NP_001012772 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001012754 |
Tested Species Reactivity |
Human |
Gene Symbol |
NHLRC3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 75% |
Image 1 | Human HepG2
| WB Suggested Anti-RP11-50D16.3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
|
|