RP11-50D16.3 Antibody - middle region (ARP44638_P050)

Data Sheet
 
Product Number ARP44638_P050
Product Page www.avivasysbio.com/rp11-50d16-3-antibody-middle-region-arp44638-p050.html
Name RP11-50D16.3 Antibody - middle region (ARP44638_P050)
Protein Size (# AA) 347 amino acids
Molecular Weight 38kDa
NCBI Gene Id 387921
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name NHL repeat containing 3
Alias Symbols DKFZp313M1221, DKFZp686E1140, LOC387921, RP11-50D16.3
Peptide Sequence Synthetic peptide located within the following region: LVQVLGTPGKKGTSLNPLQFDNPAELYVEDTGDIYIVDGDGGLNNRLIKL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Description of Target RP11-50D16.3 contains 4 NHL repeats. The function of the RP11-50D16.3 protein remains unknown.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NHLRC3 (ARP44638_P050) antibody
Blocking Peptide For anti-NHLRC3 (ARP44638_P050) antibody is Catalog # AAP44638 (Previous Catalog # AAPP12110)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RP11-50D16.3
Uniprot ID Q5JS37
Protein Name NHL repeat-containing protein 3
Protein Accession # NP_001012772
Purification Affinity Purified
Nucleotide Accession # NM_001012754
Tested Species Reactivity Human
Gene Symbol NHLRC3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
Image 1
Human HepG2
WB Suggested Anti-RP11-50D16.3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com