| Product Number |
ARP44636_P050 |
| Product Page |
www.avivasysbio.com/agpat2-antibody-c-terminal-region-arp44636-p050.html |
| Name |
AGPAT2 Antibody - C-terminal region (ARP44636_P050) |
| Protein Size (# AA) |
278 amino acids |
| Molecular Weight |
31kDa |
| NCBI Gene Id |
10555 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) |
| Description |
|
| Alias Symbols |
BSCL, BSCL1, LPAAB, 1-AGPAT2, LPAAT-beta |
| Peptide Sequence |
Synthetic peptide located within the following region: QVPIVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
AGPAT2 is a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in its gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. |
| Protein Interactions |
ABCG8; PHRF1; PHF11; ANKRD28; SLC23A2; GMPS; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-AGPAT2 (ARP44636_P050) antibody |
| Blocking Peptide |
For anti-AGPAT2 (ARP44636_P050) antibody is Catalog # AAP44636 |
| Uniprot ID |
O15120 |
| Protein Name |
1-acyl-sn-glycerol-3-phosphate acyltransferase beta |
| Publications |
Fetuin-A modulates lipid mobilization in bovine adipose tissue by enhancing lipogenic activity of adipocytes. J Dairy Sci. 102, 4628-4638 (2019). 30827564 |
| Protein Accession # |
NP_006403 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006412 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
AGPAT2 |
| Predicted Species Reactivity |
Human, Cow, Dog, Horse, Yeast |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 92%; Horse: 77%; Human: 100%; Yeast: 91% |
| Image 1 | Human heart
 | Rabbit Anti-AGPAT2 Antibody
Catalog Number: ARP44636_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: N/A
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
| Image 2 | Human 721_B
 | WB Suggested Anti-AGPAT2 Antibody
Titration: 1.0 ug/ml
Positive Control: 721_B Whole Cell |
|
| Image 3 | Heart
 | Rabbit Anti-AGPAT2 antibody
Catalog Number: ARP44636
Formalin Fixed Paraffin Embedded Tissue: Human Adult Heart
Observed Staining: Cytoplasm in hepatocytes
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
|
|
